Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate CA265_RS08355 CA265_RS08355 short-chain dehydrogenase
Query= metacyc::MONOMER-20835 (262 letters) >FitnessBrowser__Pedo557:CA265_RS08355 Length = 254 Score = 119 bits (297), Expect = 8e-32 Identities = 77/248 (31%), Positives = 130/248 (52%), Gaps = 12/248 (4%) Query: 14 RVLISGGAAGIGEVLAAAYLEAGAQVHVCDVSESALAVFRD--KYPGTVATR--ADVSDA 69 + +++GG +GIG+ +A + GA+VH+ ++ D K G VA DVSD Sbjct: 8 KAVVTGGGSGIGKAIATILAKQGAEVHIIELGTEHAQDTLDEIKTNGGVAFSYGCDVSDH 67 Query: 70 AQIEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTAQYRFAHHAV 129 + AVF +G +++L+NNAGIA G D +A++ + +N+ Y H A+ Sbjct: 68 QAVAAVFN----EIGNINILINNAGIAH-IGKADTTDEADFDRVMRVNVKGVYNCLHAAI 122 Query: 130 PMLKESSHGHLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESDIRVNALLPG 189 P ++ S G ++++AS+A +G R Y+A K A+ + S+A + +IR N++ P Sbjct: 123 PQIRLSGGGVIINMASIAALIGLPDRFVYSAAKGAVKAITMSVAKDYIGENIRCNSISPA 182 Query: 190 IVEGPRMDGVIRARAEQVGVPEAEMRQEYLNKISLKRMVTAEDVAAMALFLCSPAARNVT 249 V P +DG ++ +P EM ++ + RM E+V A+AL+LCS A +T Sbjct: 183 RVHTPFVDGFLQKNYPD-NIP--EMFEKLSKTQPIGRMAKPEEVGALALYLCSDEASFIT 239 Query: 250 GQAISVDG 257 G +DG Sbjct: 240 GCDYPIDG 247 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 254 Length adjustment: 24 Effective length of query: 238 Effective length of database: 230 Effective search space: 54740 Effective search space used: 54740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory