Align alcohol dehydrogenase (EC 1.1.1.1) (characterized)
to candidate CA265_RS12005 CA265_RS12005 glutathione-dependent formaldehyde dehydrogenase
Query= BRENDA::B2ZRE3 (347 letters) >FitnessBrowser__Pedo557:CA265_RS12005 Length = 385 Score = 230 bits (587), Expect = 4e-65 Identities = 137/383 (35%), Positives = 205/383 (53%), Gaps = 40/383 (10%) Query: 1 MRAVVFENKERVAVKEVNAPRLQHPLDALVRVHLAGICGSDLHLYHGKIPVLPGSVLGHE 60 M+A VF + V V P++ P D +++V ICGSDLH+ G +P ++GHE Sbjct: 1 MKAAVFHKPGDIRVDYVPDPKILDPRDVILKVTSTAICGSDLHILSGAVPQKDPLIMGHE 60 Query: 61 FVGQVEAVGEGIQDLQPGDWVVGPFHIACGTCPYCRRHQYNLCERGGVYGYGP------- 113 F+G VE VG I +L+ GD VV PF I+CG C +C CE YGP Sbjct: 61 FMGIVEEVGASITNLKRGDRVVVPFPISCGKCFFCTHEASPACETSNFKNYGPNGDMMSQ 120 Query: 114 ----------MFGNLQGAQAEILRVPFSNVNLRKLPPNLSPERAIFAGDILSTAYGGLIQ 163 ++G G QA+ +RVP+++++ R +P +LS E+A+F DI T + + Sbjct: 121 KGAALFGYTDLYGGYSGGQAQYVRVPYADISPRIVPEHLSDEQALFLTDIFPTGWSAIDW 180 Query: 164 GQLRPGDSVAVIGAGPVGLMAIEVAQVLGASKILAIDRIPERLERAASLGAIPI-NAEQE 222 QL+ G+ VA+ G+GPVGLMA + A + GAS+++AID + RLE+A ++ + I N + Sbjct: 181 AQLKGGEVVAIFGSGPVGLMAQKAAWINGASRVIAIDPLDYRLEKAKAVNNVDILNPHKV 240 Query: 223 NPVRRVRSETNDEGPDLVLEAV--------------------GGAATLSLALEMVRPGGR 262 + V +R T G DL ++AV G L + E VR G Sbjct: 241 DVVEAIREMTGGRGADLCVDAVGFEPERSFFDKVKATVHFEKGSIKVLEMCFEAVRRMGT 300 Query: 263 VSAVGVDNAPSFPFPLASGLVKDLTFRIGLANVHLYIDAVLALLASGRLQPERIVSHYLP 322 VS +GV +P FPL K +T + G A V YID ++ L+ G++ + I++H LP Sbjct: 301 VSIMGVYGSPYDNFPLFRIFDKGITIKQGQAPVLNYIDKLIGLVNEGKVVLDDIITHTLP 360 Query: 323 LEEAPRGYELFDRKE--ALKVLL 343 LE+A GY++FD KE +KV+L Sbjct: 361 LEDAAHGYKIFDNKEEDCVKVVL 383 Lambda K H 0.321 0.141 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 405 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 385 Length adjustment: 30 Effective length of query: 317 Effective length of database: 355 Effective search space: 112535 Effective search space used: 112535 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory