Align fructose-bisphosphate aldolase (EC 4.1.2.13) (characterized)
to candidate CA265_RS13135 CA265_RS13135 class II fructose-bisphosphate aldolase
Query= BRENDA::P0AB71 (359 letters) >FitnessBrowser__Pedo557:CA265_RS13135 Length = 359 Score = 495 bits (1275), Expect = e-145 Identities = 235/349 (67%), Positives = 290/349 (83%), Gaps = 2/349 (0%) Query: 11 GVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIA 70 GVI GD VQ++F+ AK++ FALPAVN GT+++NAVLETA V +PV++Q SNGGA F A Sbjct: 8 GVIYGDAVQELFEQAKKHQFALPAVNVTGTNTVNAVLETAKAVNSPVMIQLSNGGAQFYA 67 Query: 71 GKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGEKH 130 GK + ++ Q A ILGA+S A HVH +AEHYGV V+LHTDH AKKLLPWIDGLLD GEK Sbjct: 68 GKSLDNEKLQ-ACILGAVSAAKHVHLLAEHYGVAVVLHTDHAAKKLLPWIDGLLDHGEKF 126 Query: 131 FAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTGGEEDGVDNSH 190 FA TGKPLFSSHM+DLSEES++EN+EI +KYL RM+K+ MT+EIELG TGGEEDGVDNS Sbjct: 127 FAETGKPLFSSHMLDLSEESIEENMEISAKYLARMAKMNMTIEIELGVTGGEEDGVDNSD 186 Query: 191 MDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPTILRDSQEYVS 250 +D+S LYTQP +V YAY ELSK+SPRFT+AA+FGNVHGVYKPGNV L P IL++SQ+++ Sbjct: 187 VDSSKLYTQPSEVAYAYEELSKVSPRFTVAAAFGNVHGVYKPGNVKLQPVILKNSQDFIK 246 Query: 251 KKHNL-PHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEA 309 +K +L +NFVFHGGSGST +EI++++SYG +KMNIDTD QWA WEG+L YYK NEA Sbjct: 247 EKFSLTAEKPINFVFHGGSGSTQEEIREAISYGAIKMNIDTDMQWAFWEGILEYYKKNEA 306 Query: 310 YLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDV 358 YLQGQ+GNP G+D+PNKKYYDPRVWLR G+ + + RL AF++LN I+V Sbjct: 307 YLQGQIGNPDGDDKPNKKYYDPRVWLRKGEETFVKRLTTAFEDLNCINV 355 Lambda K H 0.316 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 431 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 359 Length of database: 359 Length adjustment: 29 Effective length of query: 330 Effective length of database: 330 Effective search space: 108900 Effective search space used: 108900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate CA265_RS13135 CA265_RS13135 (class II fructose-bisphosphate aldolase)
to HMM TIGR01520 (fbaA: fructose-bisphosphate aldolase, class II (EC 4.1.2.13))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01520.hmm # target sequence database: /tmp/gapView.16741.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01520 [M=357] Accession: TIGR01520 Description: FruBisAldo_II_A: fructose-bisphosphate aldolase, class II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-178 577.6 1.2 5.7e-178 577.3 1.2 1.0 1 lcl|FitnessBrowser__Pedo557:CA265_RS13135 CA265_RS13135 class II fructose- Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Pedo557:CA265_RS13135 CA265_RS13135 class II fructose-bisphosphate aldolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 577.3 1.2 5.7e-178 5.7e-178 7 356 .. 7 355 .. 2 356 .. 0.99 Alignments for each domain: == domain 1 score: 577.3 bits; conditional E-value: 5.7e-178 TIGR01520 7 tgvilgedvaklfevakeekfaiPainvvssetvnaaleaardakspiilqfsnggaafiaGkGvkde 74 gvi+g+ v++lfe+ak+++fa+Pa+nv++++tvna+le+a+ ++sp+++q+sngga+f+aGk + +e lcl|FitnessBrowser__Pedo557:CA265_RS13135 7 KGVIYGDAVQELFEQAKKHQFALPAVNVTGTNTVNAVLETAKAVNSPVMIQLSNGGAQFYAGKSLDNE 74 58****************************************************************** PP TIGR01520 75 aekaasiaGaiaaaeyvrsiaekygvpvvlhtdhCakkllpyvdglleadekyfkkegkPlfsshmld 142 + +a i Ga++aa++v+ +ae+ygv vvlhtdh akkllp++dgll+++ek+f+++gkPlfsshmld lcl|FitnessBrowser__Pedo557:CA265_RS13135 75 KLQA-CILGAVSAAKHVHLLAEHYGVAVVLHTDHAAKKLLPWIDGLLDHGEKFFAETGKPLFSSHMLD 141 *999.9************************************************************** PP TIGR01520 143 lseepieenieiakkylkrmakiklileieiGitGGeedGvdneeadkeelytkPedvekvyeelski 210 lsee+ieen+ei+ kyl rmak+++++eie+G+tGGeedGvdn+++d+++lyt+P +v ++yeelsk+ lcl|FitnessBrowser__Pedo557:CA265_RS13135 142 LSEESIEENMEISAKYLARMAKMNMTIEIELGVTGGEEDGVDNSDVDSSKLYTQPSEVAYAYEELSKV 209 ******************************************************************** PP TIGR01520 211 spkfsiaaafGnvhGvykpGnvklrPdiladgqeyvaeklglkeakplsfvfhGGsGstkeeikeals 278 sp+f++aaafGnvhGvykpGnvkl+P il+++q++++ek +l ++kp++fvfhGGsGst+eei+ea+s lcl|FitnessBrowser__Pedo557:CA265_RS13135 210 SPRFTVAAAFGNVHGVYKPGNVKLQPVILKNSQDFIKEKFSLTAEKPINFVFHGGSGSTQEEIREAIS 277 ******************************************************************** PP TIGR01520 279 yGvvkvnvdtdtqyaalegildyvlknedylqsqvGnpkgeekpnkkvydPrvwlreaeksmkarvek 346 yG +k+n+dtd+q+a++egil+y++kne+ylq+q+Gnp+g +kpnkk+ydPrvwlr++e++ +r+++ lcl|FitnessBrowser__Pedo557:CA265_RS13135 278 YGAIKMNIDTDMQWAFWEGILEYYKKNEAYLQGQIGNPDGDDKPNKKYYDPRVWLRKGEETFVKRLTT 345 ******************************************************************** PP TIGR01520 347 aleelnaink 356 a+e+ln+in+ lcl|FitnessBrowser__Pedo557:CA265_RS13135 346 AFEDLNCINV 355 ********97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (357 nodes) Target sequences: 1 (359 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.83 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory