Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate CA265_RS07485 CA265_RS07485 macrolide ABC transporter ATP-binding protein
Query= reanno::Smeli:SM_b21106 (365 letters) >FitnessBrowser__Pedo557:CA265_RS07485 Length = 252 Score = 133 bits (334), Expect = 6e-36 Identities = 77/220 (35%), Positives = 127/220 (57%), Gaps = 12/220 (5%) Query: 4 VTLKKLVKRYG-ALEVVHG---IDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGGA 59 +T+K++ ++Y EV+H + L++ EF+AL+GPSG GKST + ++ L+ S G Sbjct: 6 ITIKEIGRKYVIGSEVIHALKSVSLDINKGEFVALMGPSGSGKSTLMNILGCLDTPSSGT 65 Query: 60 IEIGGRKVNDLPP------RARNISMVFQSYALYPHMTVAENMGFSLKIAGRPAEEIKTR 113 + G V+ + R + I VFQ++ L P T +N+ L AG ++ R Sbjct: 66 YVLNGTNVSHMSDDALAEVRNQEIGFVFQTFNLLPRSTSLDNVALPLIYAGTSKKDRDAR 125 Query: 114 VAEAAAILDLAHLLERRPSQLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVR 173 A A + L + ++ +P++LSGGQRQRVA+ RA++ P + L DEP NLD K ++ Sbjct: 126 AARALENVGLGNRMDHKPNELSGGQRQRVAVARALINNPSIILADEPTGNLDTKTSIEIM 185 Query: 174 TEIKKLHARMQATMIYVTHDQVEAMTLSDRIVIMRDGHIE 213 ++++H++ T+I VTH++ + + RIV MRDG IE Sbjct: 186 GLLEEIHSKGN-TIILVTHEE-DIAQHAHRIVRMRDGLIE 223 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 222 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 252 Length adjustment: 27 Effective length of query: 338 Effective length of database: 225 Effective search space: 76050 Effective search space used: 76050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory