Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate CA265_RS15880 CA265_RS15880 sugar ABC transporter ATP-binding protein
Query= reanno::Smeli:SM_b21106 (365 letters) >FitnessBrowser__Pedo557:CA265_RS15880 Length = 330 Score = 131 bits (329), Expect = 3e-35 Identities = 73/242 (30%), Positives = 137/242 (56%), Gaps = 14/242 (5%) Query: 4 VTLKKLVKRYGALEV--VHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGGAIE 61 +++K L K+Y A + + + E+K + +A++G SG GKST L+ I GL + G I Sbjct: 6 ISVKNLTKQYQAEQAGGIKNVSFEIKQGDVVAIIGESGSGKSTLLKSIYGLLKTDEGEIF 65 Query: 62 IGGRKVN----DLPPRARNISMVFQSYALYPHMTVAENMGFSLKIAGRPAEEIKTRVAEA 117 ++V L P + + MV Q ++L + V +N+ L ++KT+ + Sbjct: 66 FEDKRVKGPDEQLIPGHKQMKMVTQDFSLNIYAKVYDNIASQLSNT-----DLKTKAEKT 120 Query: 118 AAILDLAHLL---ERRPSQLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRT 174 I++ +L ++ +LSGG++QRVA+ +A+V V L DEP S +DA L+ Q+R Sbjct: 121 LQIMEHLRILPLQNKKIIELSGGEQQRVAIAKAMVADTQVLLLDEPFSQVDALLKNQLRA 180 Query: 175 EIKKLHARMQATMIYVTHDQVEAMTLSDRIVIMRDGHIEQVGTPEDVFRRPATKFVAGFI 234 +IK++ + T+I V+HD + + L+D+++I+++G + Q G P ++++ P + A + Sbjct: 181 DIKRVASETGVTVILVSHDPADGLFLADQLLILKNGELLQTGKPSEIYQHPKHIYTAQIL 240 Query: 235 GS 236 G+ Sbjct: 241 GN 242 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 213 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 330 Length adjustment: 29 Effective length of query: 336 Effective length of database: 301 Effective search space: 101136 Effective search space used: 101136 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory