Align 2-keto-3-deoxy-L-fuconate dehydrogenase; EC 1.1.1.- (characterized)
to candidate CA265_RS09980 CA265_RS09980 NAD(P)-dependent oxidoreductase
Query= SwissProt::Q8P3K4 (300 letters) >FitnessBrowser__Pedo557:CA265_RS09980 Length = 284 Score = 101 bits (252), Expect = 2e-26 Identities = 83/252 (32%), Positives = 120/252 (47%), Gaps = 19/252 (7%) Query: 56 RLQGKRCLITAAGAGIGRESALACARAGAHV----IATDIDAAALQALA-AESDAITTQL 110 +L + LIT +GIGR A+ AR GA V + DIDA Q + AE Sbjct: 37 KLNNQVALITGGDSGIGRSVAVHFAREGADVAIVYLNEDIDAKETQKMVEAEGKKCLLIK 96 Query: 111 LDVTDAA----AITALVAAHGPFDVLFNCAGY-VHQGSILDCDEPAWRRSFSINVDAMYY 165 DV A A+ + G ++L N AG V Q D +F N+ +Y Sbjct: 97 GDVKKPAFCKKAVENTIKQFGKINILVNNAGMQVPQKDPKKIDNKQLEDTFRTNIFGYFY 156 Query: 166 TCKAVLPGMLERGRGSIINMSSVASSIKGVPNRFVYGVTKAAVIGLSKAIAADYVAQGVR 225 VL + SIIN +SV ++ + PN Y TK A+ ++++A + +G+R Sbjct: 157 FAHEVLEHF--KPGDSIINTTSV-TAYRSSPNLIDYSSTKGAITSFTRSLATNLATKGIR 213 Query: 226 CNAICPGTIKTPSLGQRVQALGGDEQAVWKSFTDRQPMGRLGDPREIAQLVVYLASDESS 285 NA+ PG + TP + DE+ + KSF + M R G P EIA V+LASD++S Sbjct: 214 VNAVAPGPVWTPLIVSTF-----DEKKI-KSFGSQTAMERAGQPSEIAPAYVFLASDDAS 267 Query: 286 FTTGQTHIIDGG 297 F TGQ ++GG Sbjct: 268 FITGQVIHVNGG 279 Lambda K H 0.320 0.133 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 284 Length adjustment: 26 Effective length of query: 274 Effective length of database: 258 Effective search space: 70692 Effective search space used: 70692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory