Align SDR family oxidoreductase (characterized, see rationale)
to candidate CA265_RS13715 CA265_RS13715 glucose dehydrogenase
Query= uniprot:A0A4P7ABK7 (254 letters) >FitnessBrowser__Pedo557:CA265_RS13715 Length = 248 Score = 125 bits (313), Expect = 1e-33 Identities = 89/249 (35%), Positives = 125/249 (50%), Gaps = 22/249 (8%) Query: 12 TVLITAAAQGIGRASTELFAREGARVIATDISKTHLEELASIAGVETHLLDVTDDDA--- 68 T++IT A+ GIGRA LF ++G V+ ++++L + G + L V D + Sbjct: 5 TIIITGASTGIGRAIAALFLKQGHNVVINSANESNLIRAFNELGAQHQLAMVAGDISKAT 64 Query: 69 -----IKALVAKVGTVDVLFNCAGYVAAGNILECDDKAWDFSFNLNAKAMFHTIRAVLPG 123 ++ VA+ GTVDVL N AG LE D+ D N+N K F T +A + Sbjct: 65 TGQLLVETAVARFGTVDVLVNNAGIFEPKAFLEVDEAHLDSFLNINLKGTFFTSQAAIAQ 124 Query: 124 MLAKKAGSIVNIASA-ASSVKGVANRFAYGASKAAVVGLTKSVAADFVSQGIRCNAICPG 182 ML + GSI+NI + G A +SK + LTK +AA+F IR N I PG Sbjct: 125 MLKQDGGSIINIGTVLVDHAIGGFPATAPISSKGGIHALTKQLAAEFGKNNIRVNGIAPG 184 Query: 183 TIESPSLNQRISTQAKETGKSEDEVRAAFVARQPMGRIGKAEEVAALALYLASDESNFTT 242 I SP Q K + D++ + + RIG+ ++VA LALYLA ESNF T Sbjct: 185 IIRSP-------LQEKNGISNADDLAGLHL----LNRIGETQDVAQLALYLA--ESNFVT 231 Query: 243 GSIHMIDGG 251 G I +DGG Sbjct: 232 GEIINLDGG 240 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 248 Length adjustment: 24 Effective length of query: 230 Effective length of database: 224 Effective search space: 51520 Effective search space used: 51520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory