GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fucP in Pedobacter sp. GW460-11-11-14-LB5

Align L-fucose-proton symporter; 6-deoxy-L-galactose permease; L-fucose permease (characterized)
to candidate CA265_RS04675 CA265_RS04675 L-fucose:H+ symporter permease

Query= SwissProt::P11551
         (438 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS04675 CA265_RS04675 L-fucose:H+
           symporter permease
          Length = 436

 Score =  330 bits (845), Expect = 7e-95
 Identities = 175/407 (42%), Positives = 246/407 (60%), Gaps = 7/407 (1%)

Query: 22  RSYIIPFALLCSLFFLWAVANNLNDILLPQFQQAFTLTNFQAGLIQSAFYFGYFIIPIPA 81
           + Y+ P  L+ SLFF W   +NL+ +L+P  ++AF L  F++ L+ S+ +  YF++ +PA
Sbjct: 19  KGYLFPLILVTSLFFFWGFVHNLDPVLIPHLRKAFQLNVFESTLVDSSVFIAYFLLALPA 78

Query: 82  GILMKKLSYKAGIITGLFLYALGAALFWPAAEIMNYTLFLVGLFIIAAGLGCLETAANPF 141
           G +M+K  YK+GII GL L+A+G  LF PAA    Y  FL  LFIIA GL  LETAANP+
Sbjct: 79  GYIMRKYGYKSGIILGLVLFAIGCLLFIPAANTAQYIFFLGALFIIACGLTFLETAANPY 138

Query: 142 VTVLGPESSGHFRLNLAQTFNSFGAIIAVVFGQSLILSNVPHQSQDVLDKMSPEQLSAYK 201
           VTVLGP  +   RLN +Q+FN   A +A V G   I + V +     L KM P +  AY 
Sbjct: 139 VTVLGPPETATQRLNFSQSFNGLAAFLAPVLGGKFIFTEVKYTDAQ-LAKMLPLEKQAYM 197

Query: 202 HSLVLSVQTPYMIIVAIVLLVALLIMLTKFPALQSDNHSDAKQGSFSASLSRLARIRHWR 261
                +V+ PY+I+  ++++VA+L + TK P ++ + ++  K     +S S +    H R
Sbjct: 198 LEEASTVKAPYLILGILIIVVAILFIFTKLPDIKEEENAQEK-----SSFSHVLGHSHLR 252

Query: 262 WAVLAQFCYVGAQTACWSYLIRYAVEEIPGMTAGFAANYLTGTMVCFFIGRFTGTWLISR 321
           WA++ QF YVGAQ    S  I + V    G++   A  Y     + F +GRF GT+ +  
Sbjct: 253 WAIIGQFFYVGAQVCVLSLFISF-VTSSAGISQDAAKWYAGAAGLAFMVGRFAGTFFMRY 311

Query: 322 FAPHKVLAAYALIAMALCLISAFAGGHVGLIALTLCSAFMSIQYPTIFSLGIKNLGQDTK 381
            A HK+L  YALI+  L L+S FA G + + AL   S FMSI +PTIFSLGI  LG+DTK
Sbjct: 312 VAAHKLLMLYALISAVLTLVSIFASGMITVYALIGVSFFMSIMFPTIFSLGIAGLGKDTK 371

Query: 382 YGSSFIVMTIIGGGIVTPVMGFVSDAAGNIPTAELIPALCFAVIFIF 428
            GSS IVM+I+GG  + PV+G +SDA  NI    L+P +CF V+F F
Sbjct: 372 LGSSLIVMSIVGGAFLPPVLGLISDATHNIQYGYLVPFVCFLVVFYF 418


Lambda     K      H
   0.329    0.140    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 538
Number of extensions: 29
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 438
Length of database: 436
Length adjustment: 32
Effective length of query: 406
Effective length of database: 404
Effective search space:   164024
Effective search space used:   164024
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory