Align Putative amidohydrolase (characterized, see rationale)
to candidate CA265_RS08340 CA265_RS08340 amidohydrolase
Query= uniprot:A0A0H3KNC4 (296 letters) >FitnessBrowser__Pedo557:CA265_RS08340 Length = 273 Score = 173 bits (439), Expect = 3e-48 Identities = 100/284 (35%), Positives = 147/284 (51%), Gaps = 13/284 (4%) Query: 6 IDSHQHFWRYRAADYPWIGAGMGVLARDYLPDALHPLMHAQALGASIAVQARAGRDETAF 65 ID+H HFW + WI M + D+ P L + H + IAVQA +E F Sbjct: 2 IDTHVHFWNFDPVRDSWINEEMPAIRHDFSPKDLTAVYHDLQITGCIAVQASQSEEENRF 61 Query: 66 LLELACDEARIAAVVGWEDLRAPQLAERVAEWRG-TKLRGFRHQLQDEADVRAFVDDADF 124 LL LA + + +VGW DL P L ER+ W K++G+RH LQ A+ F+ + F Sbjct: 62 LLSLAEENEMVKGIVGWVDLLDPNLDERLTYWSNFKKIKGWRHILQ--AENADFILNKKF 119 Query: 125 ARGVAWLQANDYVYDVLVFERQLPDVQAFCARHDAHWLVLDHAGKPALAEFDRDDTALAR 184 GV L+ Y YD+L + QL D+ + VLDH GKP D + Sbjct: 120 IAGVNLLKKYHYTYDLLCYHDQLADIIKMVDQIPDQPFVLDHCGKP-----DVKSQEIKS 174 Query: 185 WRAALRELAALPHVVCKLSGLVTEADWRRGLRASDLRHIEQCLDAALDAFGPQRLMFGSD 244 W ++ LAA P+V+CK+SGL+TEADW++ + + C D + FG +R+M+GSD Sbjct: 175 WSENIKILAANPNVLCKVSGLLTEADWKKWTE----KELFNCFDVVFEHFGTERIMYGSD 230 Query: 245 WPVCLLAASYDEVASLVERWAESRLSAAERSALWGGTAARCYAL 288 WPV LL+ Y + +LV ++ + SAAE+ ++ A Y + Sbjct: 231 WPVVLLSRPYQDWFNLVTKYT-GQFSAAEKKLIFSDNAKAFYGV 273 Lambda K H 0.325 0.136 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 8 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 273 Length adjustment: 26 Effective length of query: 270 Effective length of database: 247 Effective search space: 66690 Effective search space used: 66690 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory