Align Galactokinase; EC 2.7.1.6; Galactose kinase (uncharacterized)
to candidate CA265_RS09565 CA265_RS09565 galactokinase
Query= curated2:Q896X8 (392 letters) >FitnessBrowser__Pedo557:CA265_RS09565 Length = 388 Score = 390 bits (1002), Expect = e-113 Identities = 204/383 (53%), Positives = 262/383 (68%), Gaps = 2/383 (0%) Query: 8 MNINELKKEFIKIYGEGSMRNFFSPGRVNLIGEHIDYNGGHVFPCALNFGTLGCVRKRKD 67 MNIN L+++F + Y + + +F+PGRVNLIGEHIDYNGG V PCA+ GT + D Sbjct: 1 MNIN-LQEKFAEQYHKKADAIYFTPGRVNLIGEHIDYNGGLVMPCAITLGTWVAIAPNND 59 Query: 68 NKVNLASTNIPLKVSINLEDIKYEKKHGWGNYPKGVIKEIIDKGYKVGGMDILISGNIPN 127 N S N ++ ++ I + W NYP GVI E I G ++ G+D L GNIP Sbjct: 60 NLFRFKSLNFDVQTAVTSNTINEKDGSLWANYPVGVINEFIKDGKEINGLDFLFYGNIPI 119 Query: 128 GSGLSSSASLELLIAIMINNIFNDGKLDKVELIKLSQKAENDFVGLNCGIMDQFAVAMGK 187 GSGLSSSAS+E+ A +N N G DK++L+K++++ ENDF+GLN GIMDQFAVA G+ Sbjct: 120 GSGLSSSASIEIATAYALNTYINLG-YDKLDLVKIAKRVENDFIGLNSGIMDQFAVAFGE 178 Query: 188 KDMAILLDCNTLEYKYAPVDLGNYVITIMNTNKRRELSDSKYNERRLECEKALKLINKEK 247 K+ AI+LDC TL+YK VDLGNYV+ I+NTNK REL+DSKYNER EC+ ALKL+N+E Sbjct: 179 KNKAIVLDCETLKYKMVDVDLGNYVLAIINTNKPRELADSKYNERVAECQTALKLLNEEI 238 Query: 248 KINYLCELSLEEFESLKYLIKDNRVLNRATHVVYENERVKRAYYLLSKRNLKEFGKLLAE 307 ++YLCEL+ E+F +LI D +LNRATHVV EN+RV A L+ NL EFG+L+ Sbjct: 239 TLHYLCELTAEKFALHSHLITDQTILNRATHVVKENDRVHLAAKALNGGNLAEFGRLMYA 298 Query: 308 SHFSLRDLYEVTGKELDAIVGEALNVSGCIGARMIGAGFGGCAIALVEKSKLDLFKKKVS 367 SH SLR LYEV+GKELDA+V + IGARM GAGFGGCAIAL+EK + F K ++ Sbjct: 299 SHESLRTLYEVSGKELDAVVDFCADYEHVIGARMTGAGFGGCAIALLEKGFEEDFAKNLT 358 Query: 368 NNYNKIIGYKPGFYTSEIGEGTY 390 + Y + IGY Y SEIG G Y Sbjct: 359 DYYVEKIGYPAAIYISEIGNGPY 381 Lambda K H 0.318 0.139 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 495 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 388 Length adjustment: 31 Effective length of query: 361 Effective length of database: 357 Effective search space: 128877 Effective search space used: 128877 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate CA265_RS09565 CA265_RS09565 (galactokinase)
to HMM TIGR00131 (galK: galactokinase (EC 2.7.1.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00131.hmm # target sequence database: /tmp/gapView.1819795.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00131 [M=388] Accession: TIGR00131 Description: gal_kin: galactokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.4e-110 353.4 0.2 8.8e-110 353.1 0.2 1.0 1 lcl|FitnessBrowser__Pedo557:CA265_RS09565 CA265_RS09565 galactokinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Pedo557:CA265_RS09565 CA265_RS09565 galactokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 353.1 0.2 8.8e-110 8.8e-110 3 383 .. 4 378 .. 2 381 .. 0.96 Alignments for each domain: == domain 1 score: 353.1 bits; conditional E-value: 8.8e-110 TIGR00131 3 evkkiFasaykekpdlvvraPGRvnliGehiDYndgsvlPlaidvdtlvavkerddknvsitlanadn 70 +++++Fa++y++k+d + ++PGRvnliGehiDYn+g v+P+ai+++t va++ +d+ + + n+d lcl|FitnessBrowser__Pedo557:CA265_RS09565 4 NLQEKFAEQYHKKADAIYFTPGRVNLIGEHIDYNGGLVMPCAITLGTWVAIAPNNDNLFRFKSLNFDV 71 6899***************************************************************7 PP TIGR00131 71 klaerkldlpldksevsdWanYvkgvlkvlqeRfnsvplGldivisgdvPtgaGLsssaalevavaav 138 ++a ++ +++++ s WanY+ gv++++ + ++++ Gld ++ g++P g+GLsssa++e+a a lcl|FitnessBrowser__Pedo557:CA265_RS09565 72 QTAVTS--NTINEKDGSLWANYPVGVINEFIKDGKEIN-GLDFLFYGNIPIGSGLSSSASIEIATAYA 136 776655..5677777799******************99.***************************** PP TIGR00131 139 lknlgkleldskeillriqkveehfvGvncGgmDqlasvlGeedhallvefrkLkatpvklpqleial 206 l+ + +l d+ + ++ +++ve+ f+G n+G+mDq+a+++Ge++ a+++++++Lk++ v ++ + l lcl|FitnessBrowser__Pedo557:CA265_RS09565 137 LNTYINLGYDKLDLVKIAKRVENDFIGLNSGIMDQFAVAFGEKNKAIVLDCETLKYKMVDVDLGNYVL 204 ***************************************************************9**** PP TIGR00131 207 viantnvksnlapseYnlRrqeveeaakvlakksekgaLrDvkeeefaryearltkllqlvekqRakh 274 i+ntn++++la+s+Yn R+ e+++a+k l+++ L +++ e+fa +++ ++ + +Ra h lcl|FitnessBrowser__Pedo557:CA265_RS09565 205 AIINTNKPRELADSKYNERVAECQTALKLLNEEITLHYLCELTAEKFA---LHSHLITDQTILNRATH 269 ************************************************...66777777776678*** PP TIGR00131 275 vvsenlRvlkavkllkdedlkelGkLmnesqasldddyeitvpeidelvesialvnGsiGsRltGaGf 342 vv+en Rv a+k+l+ ++l e+G+Lm +s++sl+ +ye++ e+d v a+ + +iG+R+tGaGf lcl|FitnessBrowser__Pedo557:CA265_RS09565 270 VVKENDRVHLAAKALNGGNLAEFGRLMYASHESLRTLYEVSGKELDAVVDFCADYEHVIGARMTGAGF 337 ******************************************************************** PP TIGR00131 343 GGCtvalvpnenvekvrkalaekYekktdlklefavivske 383 GGC +al+++++ e++ k l++ Y +k + + ++ ++++ lcl|FitnessBrowser__Pedo557:CA265_RS09565 338 GGCAIALLEKGFEEDFAKNLTDYYVEKIGYPAAIYISEIGN 378 ******************************99999988776 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (388 nodes) Target sequences: 1 (388 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 14.80 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory