Align D-gluconate kinase, thermosensitive (EC 2.7.1.12) (characterized)
to candidate CA265_RS25410 CA265_RS25410 gluconate kinase
Query= ecocyc::GLUCONOKINI-MONOMER (187 letters) >FitnessBrowser__Pedo557:CA265_RS25410 Length = 168 Score = 150 bits (380), Expect = 9e-42 Identities = 77/167 (46%), Positives = 109/167 (65%), Gaps = 1/167 (0%) Query: 1 MAGESFILMGVSGSGKTLIGSKVAALLSAKFIDGDDLHPAKNIDKMSQGIPLSDEDRLPW 60 MAG ILMGVSGSGKT+IG +A ++A+FIDGD+LH +N+DKM+ GIPL+D DRL W Sbjct: 1 MAG-FIILMGVSGSGKTVIGKALAPKINAEFIDGDNLHSQRNVDKMAAGIPLTDADRLDW 59 Query: 61 LERLNDASYSLYKKNETGFIVCSSLKKQYRDILRKGSPHVHFLWLDGDYETILARMQRRA 120 L+ + + I CS+LKK YR++LR +P + F++L G + I R+ +R+ Sbjct: 60 LQLIAKVGREHVAHGTSCIIACSALKKSYRNLLRNDNPSIRFVYLQGSFGLIHDRIAKRS 119 Query: 121 GHFMPVALLKSQFEALERPQADEQDIVRIDINHDIANVTEQCRQAVL 167 +MP +LLKSQFE LE P ADE D+V + I+ I + + +A L Sbjct: 120 HQYMPASLLKSQFETLEEPLADEGDVVTVLIDQSIPEIVNEIVKADL 166 Lambda K H 0.320 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 98 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 187 Length of database: 168 Length adjustment: 19 Effective length of query: 168 Effective length of database: 149 Effective search space: 25032 Effective search space used: 25032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory