Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate CA265_RS15880 CA265_RS15880 sugar ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF2754 (331 letters) >FitnessBrowser__Pedo557:CA265_RS15880 Length = 330 Score = 137 bits (345), Expect = 4e-37 Identities = 85/273 (31%), Positives = 153/273 (56%), Gaps = 12/273 (4%) Query: 2 TALQLTNVCKSFGPVEV--LKDINLTVEDGEFVVFVGPSGCGKSTLLRVISGLEDATAGE 59 T + + N+ K + + +K+++ ++ G+ V +G SG GKSTLL+ I GL GE Sbjct: 4 TIISVKNLTKQYQAEQAGGIKNVSFEIKQGDVVAIIGESGSGKSTLLKSIYGLLKTDEGE 63 Query: 60 ISIGGQTVTTTP----PAKRGIAMVFQSYALYPHLSVRENMALALKQ-ERQPKEEIAARV 114 I + V P + + MV Q ++L + V +N+A L + + K E ++ Sbjct: 64 IFFEDKRVKGPDEQLIPGHKQMKMVTQDFSLNIYAKVYDNIASQLSNTDLKTKAEKTLQI 123 Query: 115 AEASRMLSLEDYLDRRPSELSGGQRQRVAIGRAVVREPKLFLFDEPLSNLDAALRMNTRL 174 E R+L L++ ++ ELSGG++QRVAI +A+V + ++ L DEP S +DA L+ R Sbjct: 124 MEHLRILPLQN---KKIIELSGGEQQRVAIAKAMVADTQVLLLDEPFSQVDALLKNQLRA 180 Query: 175 EIARLHRQLSASMIYVTHDQIEAMTLADKIVVLRDGRIEQVGTPMELYNNPANRFVAEFI 234 +I R+ + ++I V+HD + + LAD++++L++G + Q G P E+Y +P + + A+ + Sbjct: 181 DIKRVASETGVTVILVSHDPADGLFLADQLLILKNGELLQTGKPSEIYQHPKHIYTAQIL 240 Query: 235 G-APAMNFVPAQRLG-GNPGQFIGIRPEYARIS 265 G A ++ A+++G + PE+A IS Sbjct: 241 GNAVVLSQADAEKIGLKTERNSVVFYPEWAEIS 273 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 330 Length adjustment: 28 Effective length of query: 303 Effective length of database: 302 Effective search space: 91506 Effective search space used: 91506 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory