Align ADP-specific glucokinase (EC 2.7.1.147) (characterized)
to candidate CA265_RS11300 CA265_RS11300 sugar kinase
Query= BRENDA::Q8R8N4 (312 letters) >FitnessBrowser__Pedo557:CA265_RS11300 Length = 313 Score = 161 bits (407), Expect = 2e-44 Identities = 98/312 (31%), Positives = 164/312 (52%), Gaps = 25/312 (8%) Query: 3 IGVDLGGTNIAVGLVEEDGKIIATGSRPTKPERGYEAIARDIAELSFELLQRMGISVKDV 62 IG+D+GG+++ G+V ++G+I+ + K + AI I E ++ + Sbjct: 7 IGIDVGGSSLKCGVVNQNGEILYSIIVSLKNAKTQGAIIALIVEAIHTCAKKFK---NPI 63 Query: 63 KSMGIGVPGVADNEKGIVIRAVNL-FWTKVPLAKEIRKYIDLPIYMENDANVAALAEATF 121 +GIG PG+ N K I+ A NL + ++ L + +++ I M+NDAN+ L E T+ Sbjct: 64 LGVGIGFPGIIYNNK-IIAGADNLPGFKQLALGEILQEVTRYNIVMDNDANLMGLGEMTY 122 Query: 122 GAGRGSKSSVTITLGTGVGSGFILDGKIYSGAHHFAPEIGHMVIGDNGIRCNCGKIGCFE 181 GA + V +T+GTG+G ++D K+Y G + E+GH+V+ NG+ C CG GC E Sbjct: 123 GAAKDCSDVVFLTVGTGIGGAVMIDNKLYGGFRNRGTELGHIVVQHNGLACACGGRGCLE 182 Query: 182 TYASATALIREGKKAAKRNPNTLILKFANGDIEGITAKNVIDAAKQYDEEALKIFEEYVK 241 YAS TAL+ + P E I K +++ +E A++ E + Sbjct: 183 AYASVTALLNHYQSIHPNPP------------EEIDGKYMVEKYLAREEYAVEAMESHFD 230 Query: 242 YLAVGIVNIINLFDPEVIILGGGVANAGDFLLKPLKKEVAENILFKELPYAD----IRKA 297 YLA GI++ +N+F P+ I++GGG++ +G F + +E+ I +P A + A Sbjct: 231 YLATGIISFVNVFSPQKIVIGGGISESGAFYV----REIERRIKTLAVPIAPGNELVVAA 286 Query: 298 ELGNDAGIIGAA 309 LGN AG++G A Sbjct: 287 RLGNKAGLLGCA 298 Lambda K H 0.318 0.140 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 312 Length of database: 313 Length adjustment: 27 Effective length of query: 285 Effective length of database: 286 Effective search space: 81510 Effective search space used: 81510 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory