Align 4-hydroxy-2-oxoglutarate aldolase (EC 4.1.3.16; EC 4.1.2.55) (characterized)
to candidate CA265_RS19860 CA265_RS19860 bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase
Query= metacyc::MONOMER-4906 (205 letters) >FitnessBrowser__Pedo557:CA265_RS19860 Length = 219 Score = 107 bits (268), Expect = 1e-28 Identities = 66/213 (30%), Positives = 116/213 (54%), Gaps = 20/213 (9%) Query: 9 KHKIV-AVLRA--------NSVEEAKEKALAVFEGGVHLIEITFTVPDADTVIKELSFLK 59 KHKI+ A+L +S + E +++ GV + E T A K+L ++ Sbjct: 4 KHKILDAILEQGMLPLFYQDSESGSVEILRTLYKAGVRVFEYTNRGKSALPNFKKLKEIR 63 Query: 60 EK---GAIIGAGTVTSVEQCRKAVESGAEFIVSPHLDEEISQFCKEKGVFYMPGVMTPTE 116 + +G GT+ + +E+G +FIV+P ++ +++ + G+ ++PG MTPTE Sbjct: 64 DAEMPDLYLGIGTIKTPADANAFIEAGTDFIVAPIVNPAVAEIANKIGMLWIPGCMTPTE 123 Query: 117 LVKAMKLGHTILKLFPGEVVGPQFVKAMKGPFPNVKFVPTGGV--NLDNVCEWFKAGVLA 174 + A + ++K+FP ++GP+F+ ++K F F+PTGGV N DN+ WFK+GV A Sbjct: 124 ISVAQEHKAMLIKIFPANILGPEFISSIKDLFAGQLFMPTGGVEINADNLKTWFKSGVCA 183 Query: 175 VGVGSALV------KGTPDEVREKAKAFVEKIR 201 VG+GS L+ KG +E+ + K ++ I+ Sbjct: 184 VGMGSKLISKDVMSKGLYEELFDNTKLALDLIQ 216 Lambda K H 0.318 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 131 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 205 Length of database: 219 Length adjustment: 21 Effective length of query: 184 Effective length of database: 198 Effective search space: 36432 Effective search space used: 36432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory