Align N-acetylglucosamine transporter nagP (characterized)
to candidate CA265_RS04675 CA265_RS04675 L-fucose:H+ symporter permease
Query= reanno::ANA3:7025962 (432 letters) >FitnessBrowser__Pedo557:CA265_RS04675 Length = 436 Score = 197 bits (501), Expect = 5e-55 Identities = 134/432 (31%), Positives = 216/432 (50%), Gaps = 32/432 (7%) Query: 9 KSSFLPMAIVAALFFILGFATWLNGSLMPYLKQILQLNPFQASLILFSFYIAVTFTALPS 68 K P+ +V +LFF GF L+ L+P+L++ QLN F+++L+ S +IA ALP+ Sbjct: 19 KGYLFPLILVTSLFFFWGFVHNLDPVLIPHLRKAFQLNVFESTLVDSSVFIAYFLLALPA 78 Query: 69 AWVIRKVGYKNGMALGMGIMMLAGLLFIPAAKTQIFGLFLCAQLVMGTGQTLLQTAVNPY 128 +++RK GYK+G+ LG+ + + LLFIPAA T + FL A ++ G T L+TA NPY Sbjct: 79 GYIMRKYGYKSGIILGLVLFAIGCLLFIPAANTAQYIFFLGALFIIACGLTFLETAANPY 138 Query: 129 VVRLGPEESAAARVSVMGILNKGAGVIAPLVFSALILDSFKDRIGTTLTQVQID------ 182 V LGP E+A R++ N A +AP++ I K + ++ Sbjct: 139 VTVLGPPETATQRLNFSQSFNGLAAFLAPVLGGKFIFTEVKYTDAQLAKMLPLEKQAYML 198 Query: 183 EMANSLVFPYLGMAIFIGVLALAVKKSPLPELSNEDEVAEHTDKGQIKAALSHPNLAFGV 242 E A+++ PYL + I I V+A+ + LP++ E+ E K L H +L + + Sbjct: 199 EEASTVKAPYLILGILIIVVAILFIFTKLPDIKEEENAQE---KSSFSHVLGHSHLRWAI 255 Query: 243 IALFVYVAVEVIAGDTIGTFAL-SLGVEHYGV--MTSYTMVCMVLGYTLGIILIPRFISQ 299 I F YV +V +F S G+ + ++G G + R+++ Sbjct: 256 IGQFFYVGAQVCVLSLFISFVTSSAGISQDAAKWYAGAAGLAFMVGRFAGTFFM-RYVAA 314 Query: 300 PTALMISAILGLLLTLAILFGDNNSYAIANALLVPFGGVALPDTLLFIAFLGLANAIVWP 359 LM+ A++ +LTL +F G+ L+ ++F +I++P Sbjct: 315 HKLLMLYALISAVLTLVSIFA---------------SGMITVYALIGVSFF---MSIMFP 356 Query: 360 AVWPLALSGLGKLTSTGSALLIMGIAGGAFGPLFWGLTSSATDMGQQGGYMVMLPCYLFI 419 ++ L ++GLGK T GS+L++M I GGAF P GL S AT Q GY+V C+L + Sbjct: 357 TIFSLGIAGLGKDTKLGSSLIVMSIVGGAFLPPVLGLISDATH-NIQYGYLVPFVCFLVV 415 Query: 420 LFYAVKGHKMRH 431 ++ KG K H Sbjct: 416 FYFGWKGWKPNH 427 Lambda K H 0.327 0.141 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 524 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 436 Length adjustment: 32 Effective length of query: 400 Effective length of database: 404 Effective search space: 161600 Effective search space used: 161600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory