Align Sugar ABC transporter ATP-binding protein (characterized, see rationale)
to candidate CA265_RS04200 CA265_RS04200 phosphonate ABC transporter ATP-binding protein
Query= uniprot:A0A165KQ08 (355 letters) >FitnessBrowser__Pedo557:CA265_RS04200 Length = 226 Score = 138 bits (348), Expect = 1e-37 Identities = 88/210 (41%), Positives = 118/210 (56%), Gaps = 8/210 (3%) Query: 16 KGDKSVEVLRKVDIHVAPGEFLILVGPSGCGKSTLLNIIAGLDEPTEGEIRIGGKNVVGM 75 KG K+ VLR V + GEF+ ++GPSG GKSTLLNII L+EPT G G+NV + Sbjct: 14 KGIKNY-VLRLVTTSIKQGEFVSIMGPSGAGKSTLLNIIGMLEEPTYGSYEFLGENVTSL 72 Query: 76 PPRDR------DIAMVFQSYALYPTLSVADNIGFALEMRKMPKPERQKRIDEVAAMLQIS 129 R R I VFQ+Y L ++V +NI L +K+ ER RI ++ I Sbjct: 73 NERKRIELYRNHIGFVFQAYHLIDEMTVYENIEAPLLYKKVGSAERASRIADLLDRFNIV 132 Query: 130 HLLDRRPSQLSGGQRQRVAMGRALARQPQLFLFDEPLSNLDAKLRVEMRAEIKRLHQASG 189 D P+QLSGGQ+Q V + RALA QP + L DEP NL + E+ K+L+Q G Sbjct: 133 AKKDLFPNQLSGGQQQLVGIARALAAQPSIILADEPTGNLQSAQADEIMTLFKKLNQEDG 192 Query: 190 ITSVYVTHDQVEAMTLGSRIAVMKGGVVQQ 219 IT + VTH + A G+RI + GVV++ Sbjct: 193 ITIIQVTHSEKNAQ-YGNRILHIADGVVKE 221 Lambda K H 0.318 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 355 Length of database: 226 Length adjustment: 26 Effective length of query: 329 Effective length of database: 200 Effective search space: 65800 Effective search space used: 65800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory