Align SMP-30/Gluconolaconase/LRE domain protein (characterized, see rationale)
to candidate CA265_RS13655 CA265_RS13655 hypothetical protein
Query= uniprot:B2UIY8 (300 letters) >FitnessBrowser__Pedo557:CA265_RS13655 Length = 291 Score = 116 bits (290), Expect = 7e-31 Identities = 88/285 (30%), Positives = 132/285 (46%), Gaps = 25/285 (8%) Query: 19 VGESPVWHAGEQALYWTDIPGRTLWRWNFFSGQTNNWPLPEMAGCIAMAPNGWAM-AMET 77 +GE WHAG Q + DI G+ + N +G+ + M G +A A N + A++ Sbjct: 16 LGEGARWHAGWQKFLFIDIKGKLIGTCNPANGKVVTKKISAMPGMLAPAENDQLLVALQG 75 Query: 78 GIFLAPPPSPGIELGPLQRLATVAHARPDMRFNDGRCDRQGRFWAGTMVLDTSLGLPLGK 137 I L + G LA P+ R NDG CD GR W GTM ++ G G Sbjct: 76 KIVLF-----NLATGKTINLAKFKED-PENRSNDGACDALGRLWVGTMNINAKHGA--GN 127 Query: 138 LYRLDAAAARTGRVDAVIDDLIVPNGLAFSPEGKTMYLSDSHASRQTVWAFDYDIDTGTP 197 LY G++ I+ V NG+ +S + +T+Y DS + AFDYD+ TG Sbjct: 128 LY------CYNGKLVKKIEGTSVSNGICWSQDNRTLYYIDSFLYH--IKAFDYDLATGNI 179 Query: 198 HNRRVFIDMNAYPGRPDGAAVDADGCYWICGNDAGFVHRFTP-DGRLDRSIAIPTSKPAM 256 N R+ +++ DG +D++G W+ V+R+ P G I I Sbjct: 180 SNERIVVEITEPNTVADGMCIDSEGMLWVAIWGGACVNRYNPLTGACIGKIEINAPNVTS 239 Query: 257 CAFGGPGLDTLFVTSIRIG---DD----PLSGATFAVRPGVTGLP 294 CAFGG ++ + +T+ + G D+ P SG+ F V+ VTGLP Sbjct: 240 CAFGGKLMNQMLITTAKDGLSADELKKYPHSGSLFMVKLKVTGLP 284 Lambda K H 0.322 0.140 0.466 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 291 Length adjustment: 26 Effective length of query: 274 Effective length of database: 265 Effective search space: 72610 Effective search space used: 72610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory