GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gdhA in Pedobacter sp. GW460-11-11-14-LB5

Align glutamate dehydrogenase (EC 1.4.1.2) (characterized)
to candidate CA265_RS03475 CA265_RS03475 glutamate dehydrogenase

Query= BRENDA::P00366
         (558 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS03475 CA265_RS03475 glutamate
           dehydrogenase
          Length = 473

 Score =  445 bits (1145), Expect = e-129
 Identities = 243/477 (50%), Positives = 316/477 (66%), Gaps = 15/477 (3%)

Query: 82  EDKLVEDL-KTRETEEQKRNRVRSILRIIKPCNHVLSLSFPIRRDDGSWEVIEGYRAQHS 140
           E+K   D+ K  ++  Q  N    +L  IK CN V    FPIRR +G +EVI+ +R +HS
Sbjct: 7   ENKFFADVCKNFDSAAQFTNHPEGLLNQIKTCNSVYRFQFPIRRGNG-FEVIDAWRVEHS 65

Query: 141 QHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKNYTDNELEK 200
            H +P KGGIRYS  V+ DEV ALA+LMTYKCA+V+VPFGGAK G+KIN K Y+  ELE 
Sbjct: 66  HHMSPTKGGIRYSEMVNEDEVMALAALMTYKCAIVNVPFGGAKGGIKINTKQYSVAELET 125

Query: 201 ITRRFTMELAKKGFIGPGVDVPAPDMSTGEREMSWIADTYASTIGHYDINAHACVTGKPI 260
           ITRR+T EL KK FIGPG+DVPAPD  +GEREMSWIADTY  T+    ++A  CVTGKPI
Sbjct: 126 ITRRYTTELIKKNFIGPGIDVPAPDYGSGEREMSWIADTY-MTMNPGQLDALGCVTGKPI 184

Query: 261 SQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFGDKTFVVQGFGNVGLHSMRYL 320
           +  GI GR  ATGRGV + +   +  A  M+ +G   G GDK  +VQG GNVG HS ++L
Sbjct: 185 ALHGIRGRKEATGRGVAYAVRECVEVAEDMAKIGFKAGLGDKRVIVQGLGNVGYHSAKFL 244

Query: 321 HRFGAKCITVGESDGSIWNPDGIDPKELEDFKLQHGTILGFPKAKIYEGSI--LEVDCDI 378
             FGA  + + E +G+I+NP+G++  E+   +   G+ILGFP AK ++ S+  LE DCDI
Sbjct: 245 AEFGATIVGLCEFEGAIYNPNGLNVDEVFAHRKNTGSILGFPGAKDFKNSMEGLEQDCDI 304

Query: 379 LIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNIMVIPDLYLNAGGVTVS 438
           ++PAA E Q T+ N   +KAKIIAEGANGPTTPEA+ IF E   ++IPD+Y NAGGVTVS
Sbjct: 305 IVPAALENQFTELNIRNIKAKIIAEGANGPTTPEAETIFTEMGGIIIPDMYCNAGGVTVS 364

Query: 439 YFEWLNNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGKHGGTIPIVPTAEFQDRIS 498
           YFEWL NL+HV++GR+  +Y  +SN +L+     +LE   GK      I+P       + 
Sbjct: 365 YFEWLKNLSHVAFGRMENRYAANSNANLI----NTLENLTGK-----TILPEHRLM-IVK 414

Query: 499 GASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYVNAIEKVFRVYNEAGV 555
           GASE ++V+SGL  TM  S  +I  T M       LRTAA+VN+I+K+   Y   GV
Sbjct: 415 GASEMELVNSGLEDTMIHSYHEIRETLMNKPATQTLRTAAFVNSIDKIAVSYMNLGV 471


Lambda     K      H
   0.318    0.136    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 671
Number of extensions: 21
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 558
Length of database: 473
Length adjustment: 35
Effective length of query: 523
Effective length of database: 438
Effective search space:   229074
Effective search space used:   229074
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory