Align GluA aka CGL1950, component of Glutamate porter (characterized)
to candidate CA265_RS04175 CA265_RS04175 phosphonate ABC transporter ATP-binding protein
Query= TCDB::P48243 (242 letters) >FitnessBrowser__Pedo557:CA265_RS04175 Length = 232 Score = 148 bits (373), Expect = 1e-40 Identities = 86/223 (38%), Positives = 136/223 (60%), Gaps = 8/223 (3%) Query: 1 MIKMTGVQKYFG----DFHALTDIDLEIPRGQVVVVLGPSGSGKSTLCRTINRLETIEEG 56 MIK+ ++K + + AL I+L + G+ V ++GPSG GKSTL + L+ E G Sbjct: 1 MIKIENLEKVYKTEEVETTALNGINLHVAAGEFVSIMGPSGCGKSTLLNVMGLLDKPENG 60 Query: 57 TIE-IDGKVLPEEGKGLANLRA-DVGMVFQSFNLFPHLTIKDNVTLAPIKVRKMKKSEAE 114 + + ID ++L + +N R ++G VFQ+FNL LT+ +N+ L P+ K+ E + Sbjct: 61 SYKFIDTELLTLNDRERSNFRKRNMGFVFQNFNLIDELTVFENIEL-PLIYNKIPAGERK 119 Query: 115 KLAMSLLERVGIANQADKYPAQLSGGQQQRVAIARALAMNPKIMLFDEPTSALDPEMVNE 174 KL ++ER+ I N++ +P QLSGGQQQRVA+ARAL PK++L DEPT LD NE Sbjct: 120 KLVNEIIERMNIVNRSGHFPQQLSGGQQQRVAVARALVTKPKLVLADEPTGNLDSSHGNE 179 Query: 175 VLDVMASLAKEGMTMVCVTHEMGFARKAADRVLFMADGLIVED 217 V++++ L + G T+V VTH A ++R++ + DG ++ + Sbjct: 180 VMELLCELNETGTTIVMVTHSSHDA-SFSNRIINLKDGHVISE 221 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 122 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 232 Length adjustment: 23 Effective length of query: 219 Effective length of database: 209 Effective search space: 45771 Effective search space used: 45771 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory