Align Aquaporin-3, Aqp-3 of 271 aas (characterized)
to candidate CA265_RS07865 CA265_RS07865 aquaporin
Query= TCDB::729057658 (271 letters) >FitnessBrowser__Pedo557:CA265_RS07865 Length = 246 Score = 91.3 bits (225), Expect = 2e-23 Identities = 77/244 (31%), Positives = 119/244 (48%), Gaps = 44/244 (18%) Query: 26 FLAEFLGTALICYVSVIYQHGPVPAAFVVG----------LTLAWIAWVF------GPVS 69 +LAEF+GTAL+ ++ +G V + G +T AW VF GP S Sbjct: 4 YLAEFIGTALM----ILLGNGVVANVVLKGTKGNNSGWIVITTAWALAVFVGVVVAGPYS 59 Query: 70 GAHVNPVVSLMMLLVRKVWFLDALIYIVAQLLGSMAGSWIGTLAV-PAVDAGNTLGM--- 125 GAH+NP+V+L + + + + A YI+AQL G+M GS++ L DA + G+ Sbjct: 60 GAHLNPIVTLGLAIGKGFSWALAPFYIIAQLAGAMTGSFLVWLIYKDHFDATDDQGLKAA 119 Query: 126 --TTISANITVGQAIGLEIVATALLLLVILSAVD------ELRPKPWNVGNVTIFPFIFG 177 T A + + EI+ T +L+ VI D E P +G++ P F Sbjct: 120 PFATAPAIRNISSNLLSEIIGTFVLIFVIFYFTDASMGTKETVTTPIGLGSMGAIPVAFL 179 Query: 178 ATLALLASLLGDLTGASMNPARSFGPAVVN----------NNFTDLWVYIVGPFIGALLA 227 + LA LG TG ++NPAR GP +++ ++++ WV IVGP IG++LA Sbjct: 180 VWVIGLA--LGGTTGYAINPARDLGPRIIHFLIPMKGKGGSDWSYAWVPIVGPIIGSVLA 237 Query: 228 TVLY 231 V + Sbjct: 238 AVAF 241 Lambda K H 0.326 0.140 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 271 Length of database: 246 Length adjustment: 24 Effective length of query: 247 Effective length of database: 222 Effective search space: 54834 Effective search space used: 54834 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory