Align ABC transporter for Glycerol, ATPase component 1 (characterized)
to candidate CA265_RS01140 CA265_RS01140 ABC transporter
Query= reanno::acidovorax_3H11:Ac3H11_791 (363 letters) >FitnessBrowser__Pedo557:CA265_RS01140 Length = 229 Score = 100 bits (248), Expect = 5e-26 Identities = 57/179 (31%), Positives = 101/179 (56%), Gaps = 6/179 (3%) Query: 16 TWLYDMSLALQSGAVTVLLGATQAGKTSLMRIMAGLDAPTAGRVTVDGKDVTGM------ 69 T L +++ ++ +G+ + G + +GKT+L+ + AGLD ++G V ++G + + Sbjct: 22 TVLDNINFSITAGSTVAITGPSGSGKTTLLGLCAGLDRASSGTVELNGIALEKLNEDERA 81 Query: 70 PVRDRNVAMVYQQFINYPSMKVAANIASPLKLRGEKNIDARVREIASRLHIDMFLDRYPA 129 VR++ V ++Q F P++ N+ PL+LRG KNI A E+ ++ + YP Sbjct: 82 AVRNQYVGFIFQNFQLLPTLTALENVMVPLELRGAKNIRAHALELLDKVGLADRSHHYPV 141 Query: 130 ELSGGQQQRVALARALAKGAPLMLLDEPLVNLDYKLREELREELTQLFAAGQSTVVYAT 188 +LSGG+QQRV+LARA + ++ DEP NLD + E++ + L L +T++ T Sbjct: 142 QLSGGEQQRVSLARAFSNQPAILFADEPTGNLDAETSEKVIKLLFDLNKDAGTTLIIVT 200 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 229 Length adjustment: 26 Effective length of query: 337 Effective length of database: 203 Effective search space: 68411 Effective search space used: 68411 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory