Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate CA265_RS01140 CA265_RS01140 ABC transporter
Query= reanno::acidovorax_3H11:Ac3H11_2560 (259 letters) >FitnessBrowser__Pedo557:CA265_RS01140 Length = 229 Score = 130 bits (326), Expect = 3e-35 Identities = 79/216 (36%), Positives = 119/216 (55%), Gaps = 12/216 (5%) Query: 2 SSVSIQAVSRVFETAKGQRTQALQPVDFEVRDNDFVTILGPSGCGKSTLLRIVAGLDHAT 61 S ++I+ VS+++++A G+ L ++F + V I GPSG GK+TLL + AGLD A+ Sbjct: 3 SILNIRNVSKIYQSA-GRELTVLDNINFSITAGSTVAITGPSGSGKTTLLGLCAGLDRAS 61 Query: 62 SGRVLLDGAPVEGPGAER---------GMVFQSYTLFPWLTIEQNIRFGLRERGMPEAQQ 112 SG V L+G +E + G +FQ++ L P LT +N+ L RG Sbjct: 62 SGTVELNGIALEKLNEDERAAVRNQYVGFIFQNFQLLPTLTALENVMVPLELRGAKNI-- 119 Query: 113 KERAAYFIAKVGLRGFEQHFPKQLSGGMQQRTAIARALANDPKILLMDEPFGALDNQTRV 172 + A + KVGL H+P QLSGG QQR ++ARA +N P IL DEP G LD +T Sbjct: 120 RAHALELLDKVGLADRSHHYPVQLSGGEQQRVSLARAFSNQPAILFADEPTGNLDAETSE 179 Query: 173 LMQELLLGIWEAERKTVLFVTHDIDEAIFMANRVAV 208 + +LL + + T++ VTHD++ A A + + Sbjct: 180 KVIKLLFDLNKDAGTTLIIVTHDLELAARTARSIKI 215 Lambda K H 0.322 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 107 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 229 Length adjustment: 23 Effective length of query: 236 Effective length of database: 206 Effective search space: 48616 Effective search space used: 48616 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory