Align L-glutamine and L-histidine transporter (characterized)
to candidate CA265_RS15000 CA265_RS15000 amino acid permease
Query= reanno::Korea:Ga0059261_1577 (470 letters) >FitnessBrowser__Pedo557:CA265_RS15000 Length = 491 Score = 305 bits (780), Expect = 3e-87 Identities = 174/491 (35%), Positives = 267/491 (54%), Gaps = 25/491 (5%) Query: 4 GLFRTKRVKDAAEQAPEHR--LAATLSWPHLVALGVGAIVGTGILTLIGVGAGK-AGPAV 60 GLF K + E+A + L TLS LVALGVGAI+G G+ A + AGP+V Sbjct: 2 GLFTKKPMHLLLEEAGDSGKGLKRTLSAGALVALGVGAIIGAGLFVRTAAAAAQNAGPSV 61 Query: 61 IMSFVIAGAICACAALAYAEMATMMPASGSAYAYSYAVLGEIIAWVVGWSLILEYSLVVS 120 + F+IA CA A L YAE+++ +P SGSAY Y+YA +GE++AWV+GW L+LEY++ + Sbjct: 62 TIGFIIAAIGCALAGLCYAELSSSIPISGSAYTYTYATMGELMAWVIGWDLVLEYAVGAA 121 Query: 121 TVAVGWSGY----------AAPLLHAWTGMPLELMAGPHANGIVNLPAIFIIAVVAGLLC 170 TV + WS Y +P+ + W P + NGI+NLPA+FI+ +++ LL Sbjct: 122 TVGIAWSEYLNKLLVEVLHTSPIPYEWCHSPFQSHPDGTVNGIMNLPALFIVGLLSLLLI 181 Query: 171 LGTKESATLNAALVVVKIIALAVFVAVALPYFNGANLEPFAPFGFAKTISPDGVER---- 226 GT ESA +N +V+ K+ + + + + + N +N P+ P + G+ Sbjct: 182 KGTSESAFVNGLIVITKVGIVILIIVLGWGFINESNHHPYIP-AATTYVDHAGISHSFGG 240 Query: 227 --GVMAAAAIIFFAFYGFDAISTAAEETKNPGRDLAIGIVGSMIACVAIYMLVAVAAVGA 284 GV+ AA +FFAF GFDA+STAA+ETKNP + IGI+GS+ C +Y+L A G Sbjct: 241 FWGVIGAAGTVFFAFIGFDAVSTAAQETKNPKTAMPIGILGSLAVCTVLYILFAHVLTGI 300 Query: 285 TPFTHFANSPEPLALILR----DLGRPGFATFLAVSAIIALPTVLLGFLFGQSRIFFTMA 340 P F +++ G + + V+ + +V+L L GQSR+F++M+ Sbjct: 301 APVEFFRTKGGEASVVAAISEYMTGYSWLSKLVTVAILAGFSSVILVMLLGQSRVFYSMS 360 Query: 341 RDGMLPIGLAKV-SKRGSPVRITLFTAAIVAVIAGLLPIDEIAALANAGTLAAFTAVAVC 399 +DG+LP + + K +P + L IV + A +P D + + + GTL AF V V Sbjct: 361 KDGLLPKMFSDLHPKFKTPYKANLVILIIVGLFAAFIPGDVVGDMTSIGTLFAFMLVCVA 420 Query: 400 MMVLRVRAPDMPRMFRTPLWWLVGAIAVLGCIYLFFSLPVKTQLWFLAWNALGVVIYFAY 459 +++LR PD+PR F+TP L+ + V+ C + L L W ALG +IYF Y Sbjct: 421 VIILRKTDPDLPRQFKTPWVPLIPILGVVACGLMILGLGWTNWLRLFGWLALGFIIYFGY 480 Query: 460 ARPRVSAKGIE 470 ++ K ++ Sbjct: 481 SKKNSHLKDVK 491 Lambda K H 0.327 0.140 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 686 Number of extensions: 44 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 470 Length of database: 491 Length adjustment: 34 Effective length of query: 436 Effective length of database: 457 Effective search space: 199252 Effective search space used: 199252 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory