Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate CA265_RS25230 CA265_RS25230 LPS export ABC transporter ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >FitnessBrowser__Pedo557:CA265_RS25230 Length = 246 Score = 114 bits (285), Expect = 2e-30 Identities = 73/234 (31%), Positives = 117/234 (50%), Gaps = 4/234 (1%) Query: 11 LLQVNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTGSVVF 70 +L+ + Y + V +V++GEIV L+G NGAGK+T I G + G + Sbjct: 2 ILRAENLVKKYKQRTVVNNVSFNVSQGEIVGLLGPNGAGKTTSFYMIVGLIKPNEGRIFL 61 Query: 71 EGRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGAGLDNL--KHFAEDVEKIFT 128 E DIT P + A+ I + +F ++TV +N+ + N+ + + +E++ Sbjct: 62 EDEDITEDPMYRRAQKGIGYLAQEASVFRKLTVEDNILAILEMSNMSKEEQRDKLEELIN 121 Query: 129 LFPRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIFEAIRK 188 F K R RG LSGGE++ I RAL A P +LLDEP G+ P+ V+ I + K Sbjct: 122 EFSLHKVR-KNRGDLLSGGERRRTEIARALAANPNFILLDEPFAGVDPIAVEEIQSIVAK 180 Query: 189 LNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLANPEVRAAYL 242 L + + + + + N L ++ RAY++ GK+ G + L N VR YL Sbjct: 181 LKH-KNIGILITDHNVQETLSITDRAYLLFEGKILEQGVPEVLAENEMVRKVYL 233 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 246 Length adjustment: 24 Effective length of query: 223 Effective length of database: 222 Effective search space: 49506 Effective search space used: 49506 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory