Align HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate CA265_RS10520 CA265_RS10520 ABC transporter ATP-binding protein
Query= TCDB::Q9KKE1 (275 letters) >FitnessBrowser__Pedo557:CA265_RS10520 Length = 568 Score = 129 bits (323), Expect = 2e-34 Identities = 74/228 (32%), Positives = 133/228 (58%), Gaps = 6/228 (2%) Query: 43 LNDVSLKIGAGKIFVIMGLSGSGKSTLVRHINRLIEPTSGEVLFDGDNILDLGAKALRAF 102 ++ ++ ++ G+ ++G SG GK+TL R I RLI+PTSGE++F+G+NI +G ALR Sbjct: 336 VDQLNFEVFPGETLGLVGESGCGKTTLGRTILRLIQPTSGEIIFNGENITHIGKTALRKL 395 Query: 103 RMRRVSMVFQS--FALMPHRTVLQNVVYGQRVRGVSKDDA--REIGMKWIDTVGLSG-YD 157 R + + ++FQ +L P ++ Q+++ +V + ++D+ ++ ++ +D VGL + Sbjct: 396 R-KDIQIIFQDPYASLNPKLSIGQSILEPLQVHKLYRNDSERKQKVLELLDKVGLKEEHF 454 Query: 158 AKFPHQLSGGMKQRVGLARALAADTDVILMDEAFSALDPLIRGDMQDQLLQLQRNLAKTI 217 ++PH+ SGG +QRV +ARALA I+ DE+ SALD ++ + + + LQ T Sbjct: 455 NRYPHEFSGGQRQRVVIARALALQPKFIICDESVSALDVSVQAQVLNLIKDLQSEFGLTY 514 Query: 218 VFITHDLDEALRIGSEIAILRDGQVVQVGTPNDILDNPANDYVARFVQ 265 +FI+HDL I I ++ G++ + G P I P Y + ++ Sbjct: 515 IFISHDLAVVKHISDRILVMNKGKIEEEGFPEQIFYAPKAAYTQKLIE 562 Score = 108 bits (269), Expect = 3e-28 Identities = 72/227 (31%), Positives = 122/227 (53%), Gaps = 10/227 (4%) Query: 43 LNDVSLKIGAGKIFVIMGLSGSGKSTLVRHINRLIEPTS----GEVLFDGDNILDLGAKA 98 + +S K+ G + I+G SGSGKS I RL + + GE+ F+ ++L+L + Sbjct: 23 VKQISFKVKKGTVLGIVGESGSGKSVTSFSIMRLHDERAAKITGEIDFEDISLLNLSSNE 82 Query: 99 LRAFRMRRVSMVFQS--FALMPHRTVLQNVVYGQRV-RGVSKDDAREIGMKWIDTVGLSG 155 +R R ++SM+FQ +L P T V + R V + +A++ + + V L Sbjct: 83 IRQIRGNQISMIFQEPMTSLNPVFTCGYQVAEAIMLHRKVDQAEAKKHTIALFNEVQLPR 142 Query: 156 YDAKF---PHQLSGGMKQRVGLARALAADTDVILMDEAFSALDPLIRGDMQDQLLQLQRN 212 + F PHQ+SGG KQRV +A AL+ D +++ DE +ALD ++ + LL+L++ Sbjct: 143 PEKIFESYPHQISGGQKQRVMIAMALSCDPKLLIADEPTTALDVTVQKTILQLLLKLKQE 202 Query: 213 LAKTIVFITHDLDEALRIGSEIAILRDGQVVQVGTPNDILDNPANDY 259 ++FI+HDL I E+A++ G++V+ G I +NP + Y Sbjct: 203 RNMAMIFISHDLGVVNEIADEVAVMYKGEIVEQGPAKSIFENPQHPY 249 Lambda K H 0.323 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 275 Length of database: 568 Length adjustment: 31 Effective length of query: 244 Effective length of database: 537 Effective search space: 131028 Effective search space used: 131028 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory