Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate CA265_RS23135 CA265_RS23135 ABC transporter ATP-binding protein
Query= TCDB::Q55164 (267 letters) >FitnessBrowser__Pedo557:CA265_RS23135 Length = 302 Score = 89.0 bits (219), Expect = 1e-22 Identities = 72/232 (31%), Positives = 110/232 (47%), Gaps = 22/232 (9%) Query: 23 GLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQGEVLFNGDSI 82 GL+ +FG V + V +GSI G +GPNGAGKTT +L N ++ +V G I Sbjct: 10 GLNFNFGNQVIVKDLSLQVPKGSIYGFLGPNGAGKTTTIKILLNLLKSPSDQVFIFGKEI 69 Query: 83 GQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLINFRRVQKEERA 142 ++IA L R+ L H TG++ L ++K Sbjct: 70 NS---NRIA------------TLKRIGALVEQPAIYGHLTGKENLINRCILLGIKK---- 110 Query: 143 NREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLDEPAAGVNPTLI 202 KA ML VGL A A S G ++ L +A+AL+S+P+L+LLDEP G++P I Sbjct: 111 --NKADEMLALVGLTEAANKKANKYSLGMKQRLGIAQALISDPELLLLDEPTNGLDPNGI 168 Query: 203 GQICEHIVNW-NRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTPEQI 253 +I +++ + T LV H + I HV ++ +G+ L GT ++ Sbjct: 169 IEIRNLMIDLATKHQKTILVSSHLLAEIERTATHVGIINKGQLLFQGTINEL 220 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 302 Length adjustment: 26 Effective length of query: 241 Effective length of database: 276 Effective search space: 66516 Effective search space used: 66516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory