GapMind for catabolism of small carbon sources

 

Aligments for a candidate for bcaP in Pedobacter sp. GW460-11-11-14-LB5

Align Branched chain amino acid (Leucine/isoleucine/valine) uptake transporter of 469 aas and 12 TMSs, BcaP or CitA (characterized)
to candidate CA265_RS15000 CA265_RS15000 amino acid permease

Query= TCDB::S6EX81
         (469 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS15000 CA265_RS15000 amino acid
           permease
          Length = 491

 Score =  263 bits (673), Expect = 7e-75
 Identities = 158/477 (33%), Positives = 251/477 (52%), Gaps = 24/477 (5%)

Query: 14  DADKHYNQVLTTRDFLALGVGTIISTSIFTLPGQVAAQFAGPGVVFSYLLAALVAGFVAL 73
           D+ K   + L+    +ALGVG II   +F      AAQ AGP V   +++AA+      L
Sbjct: 18  DSGKGLKRTLSAGALVALGVGAIIGAGLFVRTAAAAAQNAGPSVTIGFIIAAIGCALAGL 77

Query: 74  AYAEMSTVMPFAGSAYSWISVLFGEGFGWIAGWALLAEYFIAVAFVGSGFSANLQQLL-- 131
            YAE+S+ +P +GSAY++     GE   W+ GW L+ EY +  A VG  +S  L +LL  
Sbjct: 78  CYAELSSSIPISGSAYTYTYATMGELMAWVIGWDLVLEYAVGAATVGIAWSEYLNKLLVE 137

Query: 132 ----APLGF---HLPKVLANPFGTDGGVVDIISLLVILLSAIIVFRGASDAGRISQILVV 184
               +P+ +   H P   ++P GT  G++++ +L ++ L ++++ +G S++  ++ ++V+
Sbjct: 138 VLHTSPIPYEWCHSP-FQSHPDGTVNGIMNLPALFIVGLLSLLLIKGTSESAFVNGLIVI 196

Query: 185 LKVAAVIAFIIVGITVIKPANYHPFIPPHNP-------KTGFGGFSGIWSGVSMIFLAYI 237
            KV  VI  I++G   I  +N+HP+IP              FGGF G+      +F A+I
Sbjct: 197 TKVGIVILIIVLGWGFINESNHHPYIPAATTYVDHAGISHSFGGFWGVIGAAGTVFFAFI 256

Query: 238 GFDSIAANSAEAKNPQKTMPRGIIGSLLIAVVLFAAVTLVLVGMHPYSAY--AGNAAPVG 295
           GFD+++  + E KNP+  MP GI+GSL +  VL+     VL G+ P   +   G  A V 
Sbjct: 257 GFDAVSTAAQETKNPKTAMPIGILGSLAVCTVLYILFAHVLTGIAPVEFFRTKGGEASVV 316

Query: 296 WALQQ--SGYSVLSEVVTAIALAGMFIALLGMVLAGSRLLYAFGRDGLLPKGLGKMNAR- 352
            A+ +  +GYS LS++VT   LAG    +L M+L  SR+ Y+  +DGLLPK    ++ + 
Sbjct: 317 AAISEYMTGYSWLSKLVTVAILAGFSSVILVMLLGQSRVFYSMSKDGLLPKMFSDLHPKF 376

Query: 353 NLPANGVWTLAIVAIVIGAFFPFAFLAQLISAGTLIAFMFVTLGIYSLRRRQGKDLPEAT 412
             P      + I+  +  AF P   +  + S GTL AFM V + +  LR+    DLP   
Sbjct: 377 KTPYKANLVILIIVGLFAAFIPGDVVGDMTSIGTLFAFMLVCVAVIILRKTD-PDLPR-Q 434

Query: 413 YKMPFYPVLPALGFIGSLFVFWGLDVQAKLYSGIWFLIGILIYFAYGNRRSRKSEEK 469
           +K P+ P++P LG +    +  GL     L    W  +G +IYF Y  + S   + K
Sbjct: 435 FKTPWVPLIPILGVVACGLMILGLGWTNWLRLFGWLALGFIIYFGYSKKNSHLKDVK 491


Lambda     K      H
   0.328    0.143    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 653
Number of extensions: 39
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 469
Length of database: 491
Length adjustment: 34
Effective length of query: 435
Effective length of database: 457
Effective search space:   198795
Effective search space used:   198795
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory