Align 2-keto-isovalerate dehydrogenase component β subunit (EC 1.2.4.4) (characterized)
to candidate CA265_RS11665 CA265_RS11665 transketolase
Query= metacyc::MONOMER-11684 (327 letters) >FitnessBrowser__Pedo557:CA265_RS11665 Length = 806 Score = 164 bits (416), Expect = 5e-45 Identities = 96/290 (33%), Positives = 155/290 (53%), Gaps = 6/290 (2%) Query: 8 DAINLAMKEEMERDSRVFVLGEDVGRKGGVFKATAGLYEQFGEERVMDTPLAESAIAGVG 67 + +N E RD R+ GED+G G V + AGL ++GE R+ DT + E I G G Sbjct: 476 EVLNACFNENFARDPRLVAFGEDLGNIGDVNQGFAGLQAKYGELRITDTGIREMTIMGQG 535 Query: 68 IGAAMYGMRPIAEMQFADFIMPAVNQIISEAAKIRYRSNNDWSCPIVVRAPYGGGVHGAL 127 IG AM G++PIAE+Q+ D+++ A+N + + A + YR+ P++VR G + G Sbjct: 536 IGLAMRGLKPIAEIQYLDYLIFALNVLSDDLASLSYRTKGIQKAPVIVRT-RGHRLEGIW 594 Query: 128 YHSQSVEAIFANQPGLKIVMPSTPYDAKGLLKAAVRDEDPVLFFEHKRAYRLIKGEVPAD 187 + + I G+ + +P A G+ R ++P + E YRL K ++P + Sbjct: 595 HSGSPISMILGALRGMHLCVPRNMTQAAGMYNTLFRADEPAVVIECLNGYRL-KEKLPVN 653 Query: 188 --DYVLPIGKADVKREGDDITVITYGLCVHFALQAAERLEKDGISAHVVDLRTVYPLD-K 244 ++ +P+GKA+V EG DITVI+YG + +AAE L GIS ++D +T+ P D Sbjct: 654 VGEFTVPLGKAEVLEEGTDITVISYGSSLRIVQEAAEELSLLGISVEIIDPQTLLPFDTT 713 Query: 245 EAIIEAASKTGKVLLVTEDTKEGSIMSEVAAIISEH-CLFDLDAPIKRLA 293 + + + +KT K+L+V ED G+ + ++ E F LD K L+ Sbjct: 714 QVCVNSLAKTNKLLVVDEDVPGGASAYILQKVLEEQKGYFHLDGQPKTLS 763 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 533 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 806 Length adjustment: 34 Effective length of query: 293 Effective length of database: 772 Effective search space: 226196 Effective search space used: 226196 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory