Align acetyl-CoA C-acetyltransferase (EC 2.3.1.9) (characterized)
to candidate CA265_RS06590 CA265_RS06590 acetyl-CoA acetyltransferase
Query= BRENDA::P45359 (392 letters) >FitnessBrowser__Pedo557:CA265_RS06590 Length = 391 Score = 395 bits (1015), Expect = e-114 Identities = 210/392 (53%), Positives = 272/392 (69%), Gaps = 3/392 (0%) Query: 1 MKEVVIASAVRTAIGSYGKSLKDVPAVDLGATAIKEAVKKAGIKPEDVNEVILGNVLQAG 60 MKEVVI SAVRT IGS+G SL A LG AIK A++KAG+KPE + EV +GNVL A Sbjct: 1 MKEVVIVSAVRTPIGSFGGSLAQFSATQLGGFAIKAAIEKAGLKPEQIQEVYMGNVLSAN 60 Query: 61 LGQNPARQASFKAGLPVEIPAMTINKVCGSGLRTVSLAAQIIKAGDADVIIAGGMENMSR 120 LGQ PA QA+ AGLP ++PA TINKVC SG + + LAAQ I GD ++I+AGGME+MS Sbjct: 61 LGQAPATQAAKFAGLP-DLPATTINKVCASGTKAIMLAAQSIANGDNEIIVAGGMESMSN 119 Query: 121 APYLANNARWGYRMGNAKFVDEMITDGLWDAFNDYHMGITAENIAERWNISREEQDEFAL 180 PY + AR GYR+G+ + D ++ DGLWD +NDYHMG AE A NI+RE QD FA+ Sbjct: 120 VPYYLDKARNGYRLGHGQITDGLVKDGLWDVYNDYHMGSAAELCATECNINREAQDNFAI 179 Query: 181 ASQKKAEEAIKSGQFKDEIVPVVIKGRKGE-TVVDTDEHPRFGSTIEGLAKLKPAFKKDG 239 +S K+A+ A SG+F +EIV + +K RKG+ T+VDTD+ P + + LKP FKKDG Sbjct: 180 SSYKRAQAAQTSGKFANEIVAIEVKDRKGDITLVDTDDEPT-AVKFDKIPSLKPVFKKDG 238 Query: 240 TVTAGNASGLNDCAAVLVIMSAEKAKELGVKPLAKIVSYGSAGVDPAIMGYGPFYATKAA 299 TVTA NAS LND AA LV+MSA+KAKELG+ PLAKI+ Y A P P A A Sbjct: 239 TVTAANASTLNDGAAALVLMSADKAKELGLTPLAKILGYADAQQAPEWFTTAPSKAIPLA 298 Query: 300 IEKAGWTVDELDLIESNEAFAAQSLAVAKDLKFDMNKVNVNGGAIALGHPIGASGARILV 359 + KA ++++D E NEAFA S+A + L + N+VNVNGGA++LGHP+GASGARI+V Sbjct: 299 LHKANVNINDVDFFEINEAFAVVSIANNQLLALNDNQVNVNGGAVSLGHPLGASGARIVV 358 Query: 360 TLVHAMQKRDAKKGLATLCIGGGQGTAILLEK 391 TL+ + + D K G+A +C GGG +A+++ K Sbjct: 359 TLLSVLAQNDGKIGVAGICNGGGGASALVIGK 390 Lambda K H 0.315 0.132 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 454 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 391 Length adjustment: 31 Effective length of query: 361 Effective length of database: 360 Effective search space: 129960 Effective search space used: 129960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate CA265_RS06590 CA265_RS06590 (acetyl-CoA acetyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.1285.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-134 434.7 6.2 1.7e-134 434.5 6.2 1.0 1 lcl|FitnessBrowser__Pedo557:CA265_RS06590 CA265_RS06590 acetyl-CoA acetylt Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Pedo557:CA265_RS06590 CA265_RS06590 acetyl-CoA acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 434.5 6.2 1.7e-134 1.7e-134 1 384 [. 6 388 .. 6 389 .. 0.98 Alignments for each domain: == domain 1 score: 434.5 bits; conditional E-value: 1.7e-134 TIGR01930 1 ivdavRtpigklggslkelsaedLlaavikelleragldpekidevilGnvlqageqaniaReaalaa 68 iv+avRtpig++ggsl+++sa +L+ +ik+++e+agl+pe+i ev++Gnvl+a+ ++++a +aa a lcl|FitnessBrowser__Pedo557:CA265_RS06590 6 IVSAVRTPIGSFGGSLAQFSATQLGGFAIKAAIEKAGLKPEQIQEVYMGNVLSANLGQAPATQAAKFA 73 8******************************************************************* PP TIGR01930 69 glpesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakl 136 glp+ +pa+t+n+vCaSg +A++laaq+i+ G+++++vaGG+EsmS+vp++l+++ r++++lg+ + lcl|FitnessBrowser__Pedo557:CA265_RS06590 74 GLPD-LPATTINKVCASGTKAIMLAAQSIANGDNEIIVAGGMESMSNVPYYLDKA--RNGYRLGHGQI 138 ***9.************************************************98..89********* PP TIGR01930 137 edqllkdl...vktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk 201 d l+kd+ v+++++mg Ae +a++ +i+Re qD++a++S+++a++A+ +gkf++eiv +evk++ lcl|FitnessBrowser__Pedo557:CA265_RS06590 139 TDGLVKDGlwdVYNDYHMGSAAELCATECNINREAQDNFAISSYKRAQAAQTSGKFANEIVAIEVKDR 206 ***********99*****************************************************99 PP TIGR01930 202 ...kkvvskDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmseevakelgltpl 266 + v++D+++ ++ +k+ +Lkp+fk+ +g tvtA+N+s lnDGAaal+lms ++akelgltpl lcl|FitnessBrowser__Pedo557:CA265_RS06590 207 kgdITLVDTDDEPT-AVKFDKIPSLKPVFKK-DG-TVTAANASTLNDGAAALVLMSADKAKELGLTPL 271 99767778888887.8*************95.9*.6******************************** PP TIGR01930 267 arivsaavagvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelgsldlekvNv 334 a+i ++a a pe ++++p +Ai+ aL+ka+++i+d+d++EinEAFA++ +a+++ l+ l++++vNv lcl|FitnessBrowser__Pedo557:CA265_RS06590 272 AKILGYADAQQAPEWFTTAPSKAIPLALHKANVNINDVDFFEINEAFAVVSIANNQLLA-LNDNQVNV 338 ***********************************************************.889***** PP TIGR01930 335 nGGAiAlGHPlGasGarivltllkeLkergkkyGlatlCvggGqGaAvil 384 nGGA++lGHPlGasGariv+tll+ L+++++k+G+a +C+ggG ++A+++ lcl|FitnessBrowser__Pedo557:CA265_RS06590 339 NGGAVSLGHPLGASGARIVVTLLSVLAQNDGKIGVAGICNGGGGASALVI 388 ***********************************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (391 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.65 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory