Align acetyl-CoA C-acetyltransferase (EC 2.3.1.9) (characterized)
to candidate CA265_RS06590 CA265_RS06590 acetyl-CoA acetyltransferase
Query= BRENDA::P45359 (392 letters) >FitnessBrowser__Pedo557:CA265_RS06590 Length = 391 Score = 395 bits (1015), Expect = e-114 Identities = 210/392 (53%), Positives = 272/392 (69%), Gaps = 3/392 (0%) Query: 1 MKEVVIASAVRTAIGSYGKSLKDVPAVDLGATAIKEAVKKAGIKPEDVNEVILGNVLQAG 60 MKEVVI SAVRT IGS+G SL A LG AIK A++KAG+KPE + EV +GNVL A Sbjct: 1 MKEVVIVSAVRTPIGSFGGSLAQFSATQLGGFAIKAAIEKAGLKPEQIQEVYMGNVLSAN 60 Query: 61 LGQNPARQASFKAGLPVEIPAMTINKVCGSGLRTVSLAAQIIKAGDADVIIAGGMENMSR 120 LGQ PA QA+ AGLP ++PA TINKVC SG + + LAAQ I GD ++I+AGGME+MS Sbjct: 61 LGQAPATQAAKFAGLP-DLPATTINKVCASGTKAIMLAAQSIANGDNEIIVAGGMESMSN 119 Query: 121 APYLANNARWGYRMGNAKFVDEMITDGLWDAFNDYHMGITAENIAERWNISREEQDEFAL 180 PY + AR GYR+G+ + D ++ DGLWD +NDYHMG AE A NI+RE QD FA+ Sbjct: 120 VPYYLDKARNGYRLGHGQITDGLVKDGLWDVYNDYHMGSAAELCATECNINREAQDNFAI 179 Query: 181 ASQKKAEEAIKSGQFKDEIVPVVIKGRKGE-TVVDTDEHPRFGSTIEGLAKLKPAFKKDG 239 +S K+A+ A SG+F +EIV + +K RKG+ T+VDTD+ P + + LKP FKKDG Sbjct: 180 SSYKRAQAAQTSGKFANEIVAIEVKDRKGDITLVDTDDEPT-AVKFDKIPSLKPVFKKDG 238 Query: 240 TVTAGNASGLNDCAAVLVIMSAEKAKELGVKPLAKIVSYGSAGVDPAIMGYGPFYATKAA 299 TVTA NAS LND AA LV+MSA+KAKELG+ PLAKI+ Y A P P A A Sbjct: 239 TVTAANASTLNDGAAALVLMSADKAKELGLTPLAKILGYADAQQAPEWFTTAPSKAIPLA 298 Query: 300 IEKAGWTVDELDLIESNEAFAAQSLAVAKDLKFDMNKVNVNGGAIALGHPIGASGARILV 359 + KA ++++D E NEAFA S+A + L + N+VNVNGGA++LGHP+GASGARI+V Sbjct: 299 LHKANVNINDVDFFEINEAFAVVSIANNQLLALNDNQVNVNGGAVSLGHPLGASGARIVV 358 Query: 360 TLVHAMQKRDAKKGLATLCIGGGQGTAILLEK 391 TL+ + + D K G+A +C GGG +A+++ K Sbjct: 359 TLLSVLAQNDGKIGVAGICNGGGGASALVIGK 390 Lambda K H 0.315 0.132 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 454 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 391 Length adjustment: 31 Effective length of query: 361 Effective length of database: 360 Effective search space: 129960 Effective search space used: 129960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate CA265_RS06590 CA265_RS06590 (acetyl-CoA acetyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.29174.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-134 434.7 6.2 1.7e-134 434.5 6.2 1.0 1 lcl|FitnessBrowser__Pedo557:CA265_RS06590 CA265_RS06590 acetyl-CoA acetylt Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Pedo557:CA265_RS06590 CA265_RS06590 acetyl-CoA acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 434.5 6.2 1.7e-134 1.7e-134 1 384 [. 6 388 .. 6 389 .. 0.98 Alignments for each domain: == domain 1 score: 434.5 bits; conditional E-value: 1.7e-134 TIGR01930 1 ivdavRtpigklggslkelsaedLlaavikelleragldpekidevilGnvlqageqaniaReaalaa 68 iv+avRtpig++ggsl+++sa +L+ +ik+++e+agl+pe+i ev++Gnvl+a+ ++++a +aa a lcl|FitnessBrowser__Pedo557:CA265_RS06590 6 IVSAVRTPIGSFGGSLAQFSATQLGGFAIKAAIEKAGLKPEQIQEVYMGNVLSANLGQAPATQAAKFA 73 8******************************************************************* PP TIGR01930 69 glpesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakl 136 glp+ +pa+t+n+vCaSg +A++laaq+i+ G+++++vaGG+EsmS+vp++l+++ r++++lg+ + lcl|FitnessBrowser__Pedo557:CA265_RS06590 74 GLPD-LPATTINKVCASGTKAIMLAAQSIANGDNEIIVAGGMESMSNVPYYLDKA--RNGYRLGHGQI 138 ***9.************************************************98..89********* PP TIGR01930 137 edqllkdl...vktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk 201 d l+kd+ v+++++mg Ae +a++ +i+Re qD++a++S+++a++A+ +gkf++eiv +evk++ lcl|FitnessBrowser__Pedo557:CA265_RS06590 139 TDGLVKDGlwdVYNDYHMGSAAELCATECNINREAQDNFAISSYKRAQAAQTSGKFANEIVAIEVKDR 206 ***********99*****************************************************99 PP TIGR01930 202 ...kkvvskDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmseevakelgltpl 266 + v++D+++ ++ +k+ +Lkp+fk+ +g tvtA+N+s lnDGAaal+lms ++akelgltpl lcl|FitnessBrowser__Pedo557:CA265_RS06590 207 kgdITLVDTDDEPT-AVKFDKIPSLKPVFKK-DG-TVTAANASTLNDGAAALVLMSADKAKELGLTPL 271 99767778888887.8*************95.9*.6******************************** PP TIGR01930 267 arivsaavagvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelgsldlekvNv 334 a+i ++a a pe ++++p +Ai+ aL+ka+++i+d+d++EinEAFA++ +a+++ l+ l++++vNv lcl|FitnessBrowser__Pedo557:CA265_RS06590 272 AKILGYADAQQAPEWFTTAPSKAIPLALHKANVNINDVDFFEINEAFAVVSIANNQLLA-LNDNQVNV 338 ***********************************************************.889***** PP TIGR01930 335 nGGAiAlGHPlGasGarivltllkeLkergkkyGlatlCvggGqGaAvil 384 nGGA++lGHPlGasGariv+tll+ L+++++k+G+a +C+ggG ++A+++ lcl|FitnessBrowser__Pedo557:CA265_RS06590 339 NGGAVSLGHPLGASGARIVVTLLSVLAQNDGKIGVAGICNGGGGASALVI 388 ***********************************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (391 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.62 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory