Align 3-ketoacyl-CoA thiolase; Acetyl-CoA acyltransferase; Beta-ketothiolase; EC 2.3.1.16 (characterized)
to candidate CA265_RS17585 CA265_RS17585 acetyl-CoA acetyltransferase
Query= SwissProt::O32177 (391 letters) >lcl|FitnessBrowser__Pedo557:CA265_RS17585 CA265_RS17585 acetyl-CoA acetyltransferase Length = 391 Score = 388 bits (996), Expect = e-112 Identities = 199/389 (51%), Positives = 264/389 (67%), Gaps = 1/389 (0%) Query: 3 EAVIVSGARTPVGKAKKGSLATVRPDDLGAICVKETLKRAGGYEGN-IDDLIIGCATPEA 61 EA I++G RT VGKA +G R DDL A ++ + + IDD+I+G ATPEA Sbjct: 2 EAYIIAGYRTAVGKAPRGVFRFTRADDLAAEVIRALVASVPNLDNEQIDDVIVGNATPEA 61 Query: 62 EQGLNMARNIGALAGLPYTVPAITVNRYCSSGLQSIAYAAEKIMLGAYDTAIAGGAESMS 121 EQGLN+ R I + VP +TVNRYC+SGL +IA A KI G D IAGG E MS Sbjct: 62 EQGLNIGRMISLMGLDTDKVPGVTVNRYCASGLDTIATAVAKIKAGMADCIIAGGVEVMS 121 Query: 122 QVPMMGHVTRPNLALAEKAPEYYMSMGHTAEQVAKKYGVSREDQDAFAVRSHQNAAKALA 181 +P G PN +A+ P++Y MG TAE VAK+Y VSREDQDAF+++SH+ A A+ Sbjct: 122 GMPFGGWKLVPNAEVAKNNPDWYWGMGLTAEAVAKEYNVSREDQDAFSLKSHEKAIHAIK 181 Query: 182 EGKFKDEIVPVEVTVTEIGEDHKPMEKQFVFSQDEGVRPQTTADILSTLRPAFSVDGTVT 241 G KD I+P+ V + + K + +V DEG R TT D L+ L+P F G+VT Sbjct: 182 NGHLKDGILPITVNENYLDANLKKKTRSYVVDTDEGPRADTTLDKLAKLKPVFDAVGSVT 241 Query: 242 AGNSSQTSDGAAAVMLMDREKADALGLAPLVKFRSFAVGGVPPEVMGIGPVEAIPRALKL 301 AGNSSQTSDGAA V+++ +K L P+ + S+ + GVPP +MGIGP+EAIP+ALK Sbjct: 242 AGNSSQTSDGAAFVLVVSEKKMKELNAEPIARLVSYGIAGVPPRIMGIGPIEAIPKALKQ 301 Query: 302 AGLQLQDIGLFELNEAFASQAIQVIRELGIDEEKVNVNGGAIALGHPLGCTGTKLTLSLI 361 AGL+ +DI L ELNEAFASQ++ VIR L ++ + +NVNGGAIALGHPLGCTG KLT+ ++ Sbjct: 302 AGLKKEDIDLIELNEAFASQSLAVIRTLDLNPDVINVNGGAIALGHPLGCTGAKLTVQIM 361 Query: 362 HEMKRRNEQFGVVTMCIGGGMGAAGVFEL 390 +E+KR+N+++G+VTMC+G G GAAG+FEL Sbjct: 362 NELKRQNKKYGMVTMCVGTGQGAAGIFEL 390 Lambda K H 0.316 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 404 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 391 Length adjustment: 31 Effective length of query: 360 Effective length of database: 360 Effective search space: 129600 Effective search space used: 129600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate CA265_RS17585 CA265_RS17585 (acetyl-CoA acetyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.13961.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-138 447.6 0.5 2.1e-138 447.4 0.5 1.0 1 lcl|FitnessBrowser__Pedo557:CA265_RS17585 CA265_RS17585 acetyl-CoA acetylt Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Pedo557:CA265_RS17585 CA265_RS17585 acetyl-CoA acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 447.4 0.5 2.1e-138 2.1e-138 1 385 [] 5 389 .. 5 389 .. 0.95 Alignments for each domain: == domain 1 score: 447.4 bits; conditional E-value: 2.1e-138 TIGR01930 1 ivdavRtpig.klggslkelsaedLlaavikellera.gldpekidevilGnvlqageq.aniaReaa 65 i++++Rt++g + +g+++ ++a+dL+a+vi++l++ + +ld+e+id+vi+Gn+++++eq ni+R++ lcl|FitnessBrowser__Pedo557:CA265_RS17585 5 IIAGYRTAVGkAPRGVFRFTRADDLAAEVIRALVASVpNLDNEQIDDVIVGNATPEAEQgLNIGRMIS 72 89********988******************************************************9 PP TIGR01930 66 laaglpesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgk 133 l ++vp++tvnr+CaSgl+++a+a++kikaG+ad+++aGGvE mS +p++ +l +++ lcl|FitnessBrowser__Pedo557:CA265_RS17585 73 LMGLDTDKVPGVTVNRYCASGLDTIATAVAKIKAGMADCIIAGGVEVMSGMPFGGW------KLVPNA 134 98777899********************************************8544......455533 PP TIGR01930 134 akledqllkdlvktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk 201 ++ ++ mg tAe +ak+y++sRe+qD+++l+Sh+ka +Ai++g++kd i+p++v+++ lcl|FitnessBrowser__Pedo557:CA265_RS17585 135 EVAKN-----NPDWYWGMGLTAEAVAKEYNVSREDQDAFSLKSHEKAIHAIKNGHLKDGILPITVNEN 197 32222.....457789**************************************************99 PP TIGR01930 202 ...........kkvvskDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmseeva 258 + vv++Deg+r++ttl+kLakLkp+f+ gs vtAgNssq++DGAa++l++se+++ lcl|FitnessBrowser__Pedo557:CA265_RS17585 198 yldanlkkktrSYVVDTDEGPRADTTLDKLAKLKPVFDA-VGS-VTAGNSSQTSDGAAFVLVVSEKKM 263 *******99998999**********************96.797.************************ PP TIGR01930 259 kelgltplarivsaavagvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelgs 326 kel+ +p+ar+vs+++agv+p++mg+gp++Ai+kaLk+agl+ +didl+E+nEAFA+q lav++ l+ lcl|FitnessBrowser__Pedo557:CA265_RS17585 264 KELNAEPIARLVSYGIAGVPPRIMGIGPIEAIPKALKQAGLKKEDIDLIELNEAFASQSLAVIRTLD- 330 *******************************************************************. PP TIGR01930 327 ldlekvNvnGGAiAlGHPlGasGarivltllkeLkergkkyGlatlCvggGqGaAvile 385 l+++ +NvnGGAiAlGHPlG++Ga +++++++eLk+++kkyG++t+Cvg+GqGaA i+e lcl|FitnessBrowser__Pedo557:CA265_RS17585 331 LNPDVINVNGGAIALGHPLGCTGAKLTVQIMNELKRQNKKYGMVTMCVGTGQGAAGIFE 389 88******************************************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (391 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.04 # Mc/sec: 3.10 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory