Align 3-hydroxyacyl-CoA dehydrogenase IvdG; EC 1.1.1.35 (characterized, see rationale)
to candidate CA265_RS15450 CA265_RS15450 3-oxoacyl-[acyl-carrier-protein] reductase
Query= uniprot:Q8EGC1 (252 letters) >FitnessBrowser__Pedo557:CA265_RS15450 Length = 247 Score = 147 bits (371), Expect = 2e-40 Identities = 95/255 (37%), Positives = 146/255 (57%), Gaps = 19/255 (7%) Query: 3 LKDKVVVITGGAGGLGLAMAHNFAQAGAKLA---LIDVDQ-DKLERACADLGSSTEVQGY 58 L+ K ++TG + G+G +A FA+ GA +A L V++ + LE+ G T+V+GY Sbjct: 4 LEGKTALVTGASKGIGRKIAEKFAEQGANVAFTYLSSVEKGEALEQELQSFG--TKVKGY 61 Query: 59 ALDITDEEDVVAGFAYILEDFGKINVLVNNAGILRDGMLVKAKDGKVTDRMSFDQFQSVI 118 D + + I+ +FG I+++VNNAGI +DG+L+ RMS + + VI Sbjct: 62 RSDASKFAEAEQLINDIVAEFGTIDIVVNNAGITKDGLLM---------RMSEENWDDVI 112 Query: 119 NVNLTGTFLCGREAAAAMIESGQAGVIVNISSLA-KAGNVGQSNYAASKAGVAAMSVGWA 177 N+NL F + A+ M+++ + GV +N+ S+ GN GQ+NYAASKAG+ + A Sbjct: 113 NINLKSIFNVTKAASKVMMKA-RKGVFINMGSIVGTTGNGGQANYAASKAGIIGFTKSIA 171 Query: 178 KELARYNIRSAAVAPGVIATEMTAAMKPEALERLEKLVPVGRLGHAEEIASTVRFIIE-- 235 KEL NIR+ VAPG I TEMT + P+ +E EK +P+ R G E+IA+ F+ Sbjct: 172 KELGSRNIRANVVAPGFIRTEMTDILDPKVVEGWEKDIPLKRAGETEDIANVCVFLASDM 231 Query: 236 NDYVNGRVFEVDGGI 250 + YV G+ V GG+ Sbjct: 232 SAYVTGQTLSVCGGM 246 Lambda K H 0.317 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 247 Length adjustment: 24 Effective length of query: 228 Effective length of database: 223 Effective search space: 50844 Effective search space used: 50844 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory