Align acyl-CoA oxidase (EC 1.3.3.6) (characterized)
to candidate CA265_RS09630 CA265_RS09630 acyl-CoA dehydrogenase
Query= BRENDA::Q96329 (436 letters) >FitnessBrowser__Pedo557:CA265_RS09630 Length = 396 Score = 257 bits (656), Expect = 5e-73 Identities = 144/384 (37%), Positives = 216/384 (56%), Gaps = 2/384 (0%) Query: 47 DYYHFNDLLTPEEQAIRKKVRECMEKEVAPIMTEYWEKAEFPFHITPKLGAMGVAGGSIK 106 DYY ++LLT E + IR R+ ++KEV+PI+ +Y +KAEFP H+ L +G G +I Sbjct: 14 DYYLLDELLTDEHKLIRATARDWVKKEVSPIIEDYAQKAEFPKHLIKGLADIGAFGPTIP 73 Query: 107 -GYGCPGLSITANAIATAEIARVDASCSTFILVHSSLGMLTIALCGSEAQKEKYLPSLAQ 165 YG GL TA I EI R D+ + V SL M I GSE Q++KYLP LA Sbjct: 74 VEYGGAGLDYTAYGILMQEIERGDSGIRSTASVQGSLVMYPIYAYGSEEQRKKYLPKLAS 133 Query: 166 LNTVACWALTEPDNGSDASGLGTTATKVEGGWKINGQKRWIGNSTFADLLIIFARNTTTN 225 + C+ LTEPD+GS+ G+ T + +NG K WI N+ FAD+ +++A++ + Sbjct: 134 GEMMGCFGLTEPDHGSNPGGMVTNIKDAGSHYILNGAKMWISNAPFADIAVVWAKDES-G 192 Query: 226 QINGFIVKKDAPGLKATKIPNKIGLRMVQNGDILLQNVFVPDEDRLPGVNSFQDTSKVLA 285 +I G IV++ G + +K LR G+++ NV VP E+ P ++ + L Sbjct: 193 KIRGLIVERGMEGFSTPETHHKWSLRASATGELVFDNVKVPKENIFPEISGLKGPLGCLN 252 Query: 286 VSRVMVAWQPIGISMGIYDMCHRYLKERKQFGAPLAAFQLNQQKLVQMLGNVQAMFLMGW 345 +R +AW +G +M YD RY KER QFG P+ FQL Q+KL +M+ + L+ W Sbjct: 253 QARYGIAWGALGAAMDCYDTALRYSKERVQFGKPIGGFQLQQKKLAEMVTEITKGQLLVW 312 Query: 346 RLCKLYETGQMTPGQASLGKAWISSKARETASLGRELLGGNGILADFLVAKAFCDLEPIY 405 RL L + + Q S+ K A + A R++LGG GI ++ + + +LE + Sbjct: 313 RLGVLKSENRASAEQISMAKRNSVEIALDIARNARQMLGGMGITGEYSIMRHMMNLESVV 372 Query: 406 TYEGTYDINTLVTGREVTGIASFK 429 TYEGT+DI+ L+TG +VTG+ +FK Sbjct: 373 TYEGTHDIHLLITGMDVTGLNAFK 396 Lambda K H 0.319 0.133 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 436 Length of database: 396 Length adjustment: 31 Effective length of query: 405 Effective length of database: 365 Effective search space: 147825 Effective search space used: 147825 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory