Align UDP-glucose 4-epimerase; EC 5.1.3.2 (characterized, see rationale)
to candidate CA265_RS25430 CA265_RS25430 UDP-glucose 4-epimerase GalE
Query= uniprot:L0FXG3 (337 letters) >FitnessBrowser__Pedo557:CA265_RS25430 Length = 340 Score = 364 bits (935), Expect = e-105 Identities = 183/338 (54%), Positives = 238/338 (70%), Gaps = 4/338 (1%) Query: 1 MQQILITGGAGYIGSHTAVALVNAGYEPIIVDNFSNSNKEVLNGLEKILGAPVKYHEGDC 60 M +IL+TGG GYIGSHTAV L NAGYE +IVDN SNSN ++L L I G +HE D Sbjct: 1 MAKILVTGGTGYIGSHTAVELHNAGYEVVIVDNLSNSNIKILTQLHAITGKWFDFHEIDL 60 Query: 61 NDRKFMQAVFEEN-DLQGVIHFAASKAVGESTKIPLTYYSNNINSLIILLETMKQFGVKD 119 D + +Q E + D+ G+IHFAASKAVGES + PL YY NN LI LL + + + Sbjct: 61 QDDRAVQEFAENHTDIDGIIHFAASKAVGESVEQPLKYYKNNFYGLINLLTSFNR--KIN 118 Query: 120 IVFSSSCTVYGQPDKLPVKETTPRKDAESPYGNTKKICEDILTDHVKSGAPARVVALRYF 179 VFSSSCTVYGQP+ LPV E P + AESPYGNTK+I E+IL + ++ALRYF Sbjct: 119 FVFSSSCTVYGQPETLPVTEAAPVQKAESPYGNTKQIAEEILAETAAVTPALNIIALRYF 178 Query: 180 NPIGAHPSSLIGELPLGVPANLIPFVTQTGAGIREKITVFGDDYNTPDGTCIRDYIHVMD 239 NP+GAH ++LIGELP GVPANL+PF+TQ+ G R ITV+GDDY+TPDG+ IRDYIHV+D Sbjct: 179 NPVGAHETALIGELPNGVPANLVPFITQSAIGKRGPITVYGDDYDTPDGSAIRDYIHVVD 238 Query: 240 LADAHVKSIQYLAD-QPENFIDLFNVGTGNGNTVMEVIKAFEKVSEKPLNYEIGPRRSGD 298 LA AHV +I+ L + P D+FN+GTG G++V+E+I AFEKV+ + L+Y+IGPRR+GD Sbjct: 239 LAKAHVAAIKKLEEGNPNGNYDVFNIGTGKGSSVLEIIAAFEKVNGEKLDYKIGPRRAGD 298 Query: 299 IEKVWANTDKVSKVLGWTPQFGLEEALRDAWNWQLSLK 336 I +++ + K + LGW + E +R AW W+ +K Sbjct: 299 IVQIYGDVQKSNNELGWKANLDINEMMRSAWEWEKYIK 336 Lambda K H 0.316 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 398 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 340 Length adjustment: 28 Effective length of query: 309 Effective length of database: 312 Effective search space: 96408 Effective search space used: 96408 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate CA265_RS25430 CA265_RS25430 (UDP-glucose 4-epimerase GalE)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.1838872.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-123 395.9 0.1 6.6e-123 395.7 0.1 1.0 1 lcl|FitnessBrowser__Pedo557:CA265_RS25430 CA265_RS25430 UDP-glucose 4-epim Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Pedo557:CA265_RS25430 CA265_RS25430 UDP-glucose 4-epimerase GalE # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 395.7 0.1 6.6e-123 6.6e-123 1 329 [. 3 336 .. 3 339 .. 0.97 Alignments for each domain: == domain 1 score: 395.7 bits; conditional E-value: 6.6e-123 TIGR01179 1 kiLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekit..evklvegdladkekleavl 66 kiLvtGg+GyiGsh++++l ++g+evv++Dnls+++ ++l++l+ it + + e dl+d ++++++ lcl|FitnessBrowser__Pedo557:CA265_RS25430 3 KILVTGGTGYIGSHTAVELHNAGYEVVIVDNLSNSNIKILTQLHAITgkWFDFHEIDLQDDRAVQEFA 70 79********************************************998899**************99 PP TIGR01179 67 e.eekidaviHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpi 133 e +++id +iHfaa++avgEsv++PlkYY+nn + ++Ll + ++ +++Fsss++vYg++e++p+ lcl|FitnessBrowser__Pedo557:CA265_RS25430 71 EnHTDIDGIIHFAASKAVGESVEQPLKYYKNNFYGLINLLTSFNR--KINFVFSSSCTVYGQPETLPV 136 83458***********************************99976..579****************** PP TIGR01179 134 sEespln.pinpYGrsklmvErilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknat.hliklv 199 +E++p++ +++pYG++k ++E+il +++ + ++l++++LRYFn++GA+e iGe +++ + +l++ + lcl|FitnessBrowser__Pedo557:CA265_RS25430 137 TEAAPVQkAESPYGNTKQIAEEILAETAAVTPALNIIALRYFNPVGAHETALIGELPNGVPaNLVPFI 204 *****9989*********************************************************** PP TIGR01179 200 aevavgkrekleifGtdyptkDGtcvRDyiHveDlaeaHlaalealeeg...gesevynlGagqgfsv 264 ++ a+gkr ++++G+dy+t+DG ++RDyiHv Dla+aH+aa+++leeg g+++v+n+G+g+g sv lcl|FitnessBrowser__Pedo557:CA265_RS25430 205 TQSAIGKRGPITVYGDDYDTPDGSAIRDYIHVVDLAKAHVAAIKKLEEGnpnGNYDVFNIGTGKGSSV 272 ***********************************************985545899************ PP TIGR01179 265 kevieavkkvsgkdikveladrRaGDpaslvadaskikrelgwkpkyddLeeiiksawdWekklk 329 +e+i a++kv g+++ +++ +rRaGD+ ++++d +k ++elgwk+++d ++e+++saw+Wek +k lcl|FitnessBrowser__Pedo557:CA265_RS25430 273 LEIIAAFEKVNGEKLDYKIGPRRAGDIVQIYGDVQKSNNELGWKANLD-INEMMRSAWEWEKYIK 336 ***********************************************9.************9765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (340 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 26.22 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory