Align D-galactono-lactonase (EC 3.1.1.-) (characterized)
to candidate CA265_RS25055 CA265_RS25055 6-phosphogluconolactonase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_3314 (389 letters) >FitnessBrowser__Pedo557:CA265_RS25055 Length = 369 Score = 228 bits (582), Expect = 2e-64 Identities = 135/367 (36%), Positives = 212/367 (57%), Gaps = 19/367 (5%) Query: 21 ASAEDYQLLVGSYTA-GQSQGIYRLAFDSRTGQIDASPLQVIKSANPSWLTLSKDQRHLF 79 A +Y L+VG+YTA G+S+GIY F++ T + +ANPS+L +S DQ+ ++ Sbjct: 19 AQKANYNLIVGTYTAPGKSEGIYTYNFNASTAATTIKSITK-NTANPSYLAVSPDQKFVY 77 Query: 80 VVNENGPGQTDPVGRVSSFAIDPKTHALSLISQVQSLGNEPTHSSLSIDGSHLFVSNYSV 139 VVNE G T VS+F + + AL+ +++V S G +P +++D ++ V+NYS Sbjct: 78 VVNETGATST-----VSAFKYNAASGALTFLNKVDSHGADPCF--ITVDAKNVIVANYS- 129 Query: 140 AEDPGGTLAVLPVAADGKLKAVVQMSSHPASRVNPE-RQASAHVHSTIPSPDGRYVFAND 198 GG+LA+ ADG L +Q H ++P+ RQ SAHVH +PD +++ ND Sbjct: 130 ----GGSLAIFSRKADGALTEALQTIEHTGKSIDPKGRQESAHVHMVKFTPDYKHLIVND 185 Query: 199 LGADKVFAYRFDPKANPELPLTPATPAFVQLPPGSGPRHLLFSADGKHAWLTMEMSAQVA 258 LG D+++ Y + P A + LT + ++ G+GPRH+ FS +GK A+L E + + Sbjct: 186 LGEDRIYIYNYKPAAKENI-LT--VKSVIKTNAGTGPRHITFSPNGKFAYLAHEFNGSIT 242 Query: 259 VFDYHDGQLEQTQMVDLAAGQPVSDKAAAALHASADGKFLYVSNRGTANQLLVFAIDPAT 318 F Y +G L + Q + + AA +H SADGKFLY +NRG AN + F++ P T Sbjct: 243 AFAYSNGSLTKIQEIGTTSKDFTGKVDAADIHVSADGKFLYETNRGDANSISAFSVLP-T 301 Query: 319 GHLSELQRRAVEGDHPREFSLDPSGKFLLIANQKSNQIVVVERDARTGLLGKTVQKLPMD 378 G L ++ + G PR F++DP+GKFLLI +Q +N IV+ +R+ TG L + +++ + Sbjct: 302 GKLKFIETVSTLGKGPRNFTIDPTGKFLLIGHQYTNNIVIFKRNKTTGKLSDSGKRIDVG 361 Query: 379 APSDLRF 385 AP L F Sbjct: 362 APVCLVF 368 Lambda K H 0.316 0.132 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 408 Number of extensions: 28 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 369 Length adjustment: 30 Effective length of query: 359 Effective length of database: 339 Effective search space: 121701 Effective search space used: 121701 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory