Align Branched-chain-amino-acid aminotransferase 2; BCAT 2; Vegetative protein 85; VEG85; EC 2.6.1.42 (characterized)
to candidate CA265_RS22650 CA265_RS22650 branched chain amino acid aminotransferase
Query= SwissProt::P39576 (363 letters) >FitnessBrowser__Pedo557:CA265_RS22650 Length = 354 Score = 309 bits (791), Expect = 8e-89 Identities = 149/352 (42%), Positives = 228/352 (64%), Gaps = 7/352 (1%) Query: 4 QTIRVELTS---TKKPKPDPNQLSFGRVFTDHMFVMDYAADKGWYDPRIIPYQPLSMDPA 60 +T+ +++T T+ D +QL FG+VFTDHMF DY D W + +I+PY P+ M PA Sbjct: 3 ETLDIKITKADQTRLTVTDFSQLPFGKVFTDHMFTADYE-DGEWKNLQILPYGPIPMSPA 61 Query: 61 AMVYHYGQTVFEGLKAYVSEDDHVLLFRPEKNMERLNQSNDRLCIPQIDEEQVLEGLKQL 120 HYGQ +FEGLKAY D + +FR +KN ER N+S R+ +P I EE ++GL L Sbjct: 62 ISALHYGQAIFEGLKAYRQPDGKISVFRADKNFERFNKSAARMSMPGIPEEIFMQGLAAL 121 Query: 121 VAIDKDWIPNAEGTSLYIRPFIIATEPFLGVAASHTYKLLIILSPVGSYYKEGIKPVKIA 180 + +D+ W+PN E +LYIRP + A +P+LGV AS TYK ++ +P G YY +K + Sbjct: 122 INVDEKWVPNQEDYALYIRPVMFAMDPYLGVKASDTYKFALLTTPTGPYYSSALK---VK 178 Query: 181 VESEFVRAVKGGTGNAKTAGNYASSLKAQQVAEEKGFSQVLWLDGIEKKYIEEVGSMNIF 240 +E+EF RA +GG G AKTAGNYA SL + A+++G+ Q++W D + ++IEE G+ N+ Sbjct: 179 IETEFTRADEGGVGFAKTAGNYARSLYPFEQAKKEGYDQLIWTDSVTHEFIEEAGTANLL 238 Query: 241 FKINGEIVTPMLNGSILEGITRNSVIALLKHWGLQVSERKIAIDEVIQAHKDGILEEAFG 300 F ING++VTP + ++L+G+TR+++I L K G++V ER++++ EVI+ ++G L EAF Sbjct: 239 FVINGKLVTPSVRSTVLDGVTRDTIIKLAKDAGVEVEERRVSVKEVIEGIENGSLTEAFA 298 Query: 301 TGTAAVISPVGELIWQDETLSINNGETGEIAKKLYDTITGIQKGAVADEFGW 352 GTAA ++ VGE+ + + + + T I+ + + I+ G DEFGW Sbjct: 299 AGTAATVTHVGEMGYNGQIYKLTDPSTRHISNGIAKKLNDIRYGLAPDEFGW 350 Lambda K H 0.316 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 388 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 354 Length adjustment: 29 Effective length of query: 334 Effective length of database: 325 Effective search space: 108550 Effective search space used: 108550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate CA265_RS22650 CA265_RS22650 (branched chain amino acid aminotransferase)
to HMM TIGR01123 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01123.hmm # target sequence database: /tmp/gapView.1984.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01123 [M=313] Accession: TIGR01123 Description: ilvE_II: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-103 329.8 0.0 8e-103 329.6 0.0 1.0 1 lcl|FitnessBrowser__Pedo557:CA265_RS22650 CA265_RS22650 branched chain ami Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Pedo557:CA265_RS22650 CA265_RS22650 branched chain amino acid aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 329.6 0.0 8e-103 8e-103 1 309 [. 45 350 .. 45 354 .] 0.99 Alignments for each domain: == domain 1 score: 329.6 bits; conditional E-value: 8e-103 TIGR01123 1 WdeaelaseaeleldegsavlhYgqevfeGlkayRtadGkillfRpdanakRlrrsaerlllPeleee 68 W++ ++ +++++ ++++ ++lhYgq++feGlkayR+ dGki +fR+d+n +R+++sa r+++P ++ee lcl|FitnessBrowser__Pedo557:CA265_RS22650 45 WKNLQILPYGPIPMSPAISALHYGQAIFEGLKAYRQPDGKISVFRADKNFERFNKSAARMSMPGIPEE 112 999***************************************************************** PP TIGR01123 69 lflealkqlvkadkdwvpkakseasLYlRPfliatednlGvkaakeylflvlasPvGaYfkgglapvs 136 +f++ l+ l+++d++wvp+++ + +LY+RP+++a++++lGvka+ +y f +l++P G+Y+ + l++ lcl|FitnessBrowser__Pedo557:CA265_RS22650 113 IFMQGLAALINVDEKWVPNQE-DYALYIRPVMFAMDPYLGVKASDTYKFALLTTPTGPYYSSALKV-- 177 ******************888.9**************************************99988.. PP TIGR01123 137 ifveteyvRaapkGtGavkvgGnYaasllaqkkaaeqglddvvyldpvekkkieevGaaniflitkdg 204 +ete++Ra ++G+G++k++GnYa sl + ++a+++g+d+ ++ d+v+++ iee+G+an++++++ g lcl|FitnessBrowser__Pedo557:CA265_RS22650 178 -KIETEFTRADEGGVGFAKTAGNYARSLYPFEQAKKEGYDQLIWTDSVTHEFIEEAGTANLLFVIN-G 243 .79**************************************************************9.8 PP TIGR01123 205 elvttplsesiLegvtresllelakdlgleveereiaidelkaaveaGei..vfacGtaavitPvgel 270 +lvt++ +L+gvtr+ +++lakd+g+eveer++++ e+ + e+G++ +fa+Gtaa +t vge+ lcl|FitnessBrowser__Pedo557:CA265_RS22650 244 KLVTPSVRSTVLDGVTRDTIIKLAKDAGVEVEERRVSVKEVIEGIENGSLteAFAAGTAATVTHVGEM 311 ************************************************9999**************** PP TIGR01123 271 kiegkevevkseevGevtkklrdeltdiqyGkledkegW 309 +g+ +++++ + ++++ + ++l di yG + d++gW lcl|FitnessBrowser__Pedo557:CA265_RS22650 312 GYNGQIYKLTDPSTRHISNGIAKKLNDIRYGLAPDEFGW 350 *************************************** PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (313 nodes) Target sequences: 1 (354 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.66 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory