Align Branched-chain-amino-acid aminotransferase 2; BCAT 2; Vegetative protein 85; VEG85; EC 2.6.1.42 (characterized)
to candidate CA265_RS22650 CA265_RS22650 branched chain amino acid aminotransferase
Query= SwissProt::P39576 (363 letters) >FitnessBrowser__Pedo557:CA265_RS22650 Length = 354 Score = 309 bits (791), Expect = 8e-89 Identities = 149/352 (42%), Positives = 228/352 (64%), Gaps = 7/352 (1%) Query: 4 QTIRVELTS---TKKPKPDPNQLSFGRVFTDHMFVMDYAADKGWYDPRIIPYQPLSMDPA 60 +T+ +++T T+ D +QL FG+VFTDHMF DY D W + +I+PY P+ M PA Sbjct: 3 ETLDIKITKADQTRLTVTDFSQLPFGKVFTDHMFTADYE-DGEWKNLQILPYGPIPMSPA 61 Query: 61 AMVYHYGQTVFEGLKAYVSEDDHVLLFRPEKNMERLNQSNDRLCIPQIDEEQVLEGLKQL 120 HYGQ +FEGLKAY D + +FR +KN ER N+S R+ +P I EE ++GL L Sbjct: 62 ISALHYGQAIFEGLKAYRQPDGKISVFRADKNFERFNKSAARMSMPGIPEEIFMQGLAAL 121 Query: 121 VAIDKDWIPNAEGTSLYIRPFIIATEPFLGVAASHTYKLLIILSPVGSYYKEGIKPVKIA 180 + +D+ W+PN E +LYIRP + A +P+LGV AS TYK ++ +P G YY +K + Sbjct: 122 INVDEKWVPNQEDYALYIRPVMFAMDPYLGVKASDTYKFALLTTPTGPYYSSALK---VK 178 Query: 181 VESEFVRAVKGGTGNAKTAGNYASSLKAQQVAEEKGFSQVLWLDGIEKKYIEEVGSMNIF 240 +E+EF RA +GG G AKTAGNYA SL + A+++G+ Q++W D + ++IEE G+ N+ Sbjct: 179 IETEFTRADEGGVGFAKTAGNYARSLYPFEQAKKEGYDQLIWTDSVTHEFIEEAGTANLL 238 Query: 241 FKINGEIVTPMLNGSILEGITRNSVIALLKHWGLQVSERKIAIDEVIQAHKDGILEEAFG 300 F ING++VTP + ++L+G+TR+++I L K G++V ER++++ EVI+ ++G L EAF Sbjct: 239 FVINGKLVTPSVRSTVLDGVTRDTIIKLAKDAGVEVEERRVSVKEVIEGIENGSLTEAFA 298 Query: 301 TGTAAVISPVGELIWQDETLSINNGETGEIAKKLYDTITGIQKGAVADEFGW 352 GTAA ++ VGE+ + + + + T I+ + + I+ G DEFGW Sbjct: 299 AGTAATVTHVGEMGYNGQIYKLTDPSTRHISNGIAKKLNDIRYGLAPDEFGW 350 Lambda K H 0.316 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 388 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 354 Length adjustment: 29 Effective length of query: 334 Effective length of database: 325 Effective search space: 108550 Effective search space used: 108550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate CA265_RS22650 CA265_RS22650 (branched chain amino acid aminotransferase)
to HMM TIGR01123 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01123.hmm # target sequence database: /tmp/gapView.3664.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01123 [M=313] Accession: TIGR01123 Description: ilvE_II: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-103 329.8 0.0 8e-103 329.6 0.0 1.0 1 lcl|FitnessBrowser__Pedo557:CA265_RS22650 CA265_RS22650 branched chain ami Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Pedo557:CA265_RS22650 CA265_RS22650 branched chain amino acid aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 329.6 0.0 8e-103 8e-103 1 309 [. 45 350 .. 45 354 .] 0.99 Alignments for each domain: == domain 1 score: 329.6 bits; conditional E-value: 8e-103 TIGR01123 1 WdeaelaseaeleldegsavlhYgqevfeGlkayRtadGkillfRpdanakRlrrsaerlllPeleee 68 W++ ++ +++++ ++++ ++lhYgq++feGlkayR+ dGki +fR+d+n +R+++sa r+++P ++ee lcl|FitnessBrowser__Pedo557:CA265_RS22650 45 WKNLQILPYGPIPMSPAISALHYGQAIFEGLKAYRQPDGKISVFRADKNFERFNKSAARMSMPGIPEE 112 999***************************************************************** PP TIGR01123 69 lflealkqlvkadkdwvpkakseasLYlRPfliatednlGvkaakeylflvlasPvGaYfkgglapvs 136 +f++ l+ l+++d++wvp+++ + +LY+RP+++a++++lGvka+ +y f +l++P G+Y+ + l++ lcl|FitnessBrowser__Pedo557:CA265_RS22650 113 IFMQGLAALINVDEKWVPNQE-DYALYIRPVMFAMDPYLGVKASDTYKFALLTTPTGPYYSSALKV-- 177 ******************888.9**************************************99988.. PP TIGR01123 137 ifveteyvRaapkGtGavkvgGnYaasllaqkkaaeqglddvvyldpvekkkieevGaaniflitkdg 204 +ete++Ra ++G+G++k++GnYa sl + ++a+++g+d+ ++ d+v+++ iee+G+an++++++ g lcl|FitnessBrowser__Pedo557:CA265_RS22650 178 -KIETEFTRADEGGVGFAKTAGNYARSLYPFEQAKKEGYDQLIWTDSVTHEFIEEAGTANLLFVIN-G 243 .79**************************************************************9.8 PP TIGR01123 205 elvttplsesiLegvtresllelakdlgleveereiaidelkaaveaGei..vfacGtaavitPvgel 270 +lvt++ +L+gvtr+ +++lakd+g+eveer++++ e+ + e+G++ +fa+Gtaa +t vge+ lcl|FitnessBrowser__Pedo557:CA265_RS22650 244 KLVTPSVRSTVLDGVTRDTIIKLAKDAGVEVEERRVSVKEVIEGIENGSLteAFAAGTAATVTHVGEM 311 ************************************************9999**************** PP TIGR01123 271 kiegkevevkseevGevtkklrdeltdiqyGkledkegW 309 +g+ +++++ + ++++ + ++l di yG + d++gW lcl|FitnessBrowser__Pedo557:CA265_RS22650 312 GYNGQIYKLTDPSTRHISNGIAKKLNDIRYGLAPDEFGW 350 *************************************** PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (313 nodes) Target sequences: 1 (354 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.66 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory