Align Isovaleryl-CoA dehydrogenase (EC 1.3.8.4) (characterized)
to candidate CA265_RS17575 CA265_RS17575 acyl-CoA dehydrogenase
Query= reanno::acidovorax_3H11:Ac3H11_2991 (396 letters) >FitnessBrowser__Pedo557:CA265_RS17575 Length = 597 Score = 229 bits (584), Expect = 2e-64 Identities = 134/392 (34%), Positives = 214/392 (54%), Gaps = 22/392 (5%) Query: 13 QLGEDIDALRDAVRDFAQAEIAPRAADIDKSD--QFPMDLWRKMGDLGVLGITVPEQYGG 70 + E+ + RDF AE+ P IDK + + L K G+LG+LG++VPE+YGG Sbjct: 29 EFDEEQQMIAQTCRDFLAAEVYPNLDKIDKQEDPELMPTLLTKAGELGILGVSVPEEYGG 88 Query: 71 AAMGYLAHMVAMEEISRASASVGLSYGAHSNLCVNQINRNGNEAQKAKYLSKLISGEHVG 130 + M+ + + A S ++ AH+ + I GNEAQKAKY+ KL SGE Sbjct: 89 FGKNFNTSMLVADVVG-AGHSFAVALSAHTGIGTLPILYYGNEAQKAKYIPKLGSGEWKA 147 Query: 131 ALAMSEPGAGSDVISMKLKA--EDKGGYYLLNGSKMWITNGPDADTLVVYAKTEPELGAR 188 A ++EP +GSD S K KA + G +Y++ G KMWITNG AD +V+AK + + + Sbjct: 148 AYCLTEPNSGSDANSGKTKATLSEDGKHYIITGQKMWITNGGFADIFIVFAKIDDD---K 204 Query: 189 GVTAFLIEKGMKGFSIAQKLDKLGMRGSHTGELVFQDVEVPAENVLGGLNQGAKVLMSGL 248 +TAF++EK G ++ + K+G++GS T ++ F D VP EN+L G K+ ++ L Sbjct: 205 NLTAFIVEKDFGGITMNPEEHKMGIKGSSTRQVFFNDCPVPVENMLSDRENGFKIAVNIL 264 Query: 249 DYERAVLTGGPLGIMQSVMDNVIPYIHDRKQFGQSIGEFQLIQGKVADMYTVLQAGRSFA 308 + R L+ +G ++ ++ I Y ++R QFG+ I ++ I+ K+A++ + L A + Sbjct: 265 NIGRIKLSAAAIGASKATLNTAINYSNERIQFGRPISKYGAIRFKIAEIASKLYAVDAAN 324 Query: 309 YTVAKNLD--------------MLGTDHVRQVRKDCASVILWCAEKATWMAGEGVQIYGG 354 Y +N+D V Q +CA + +W +E + EGVQIYGG Sbjct: 325 YRAGQNIDDTYDQLVAGGMESGKARLKSVEQFAVECAILKVWGSEALDYTVDEGVQIYGG 384 Query: 355 NGYINEYPLGRLWRDAKLYEIGAGTSEIRRML 386 G+ + P+ R +RDA++ I GT+EI R+L Sbjct: 385 MGFSADAPMDRAYRDARINRIFEGTNEINRLL 416 Lambda K H 0.318 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 558 Number of extensions: 25 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 597 Length adjustment: 34 Effective length of query: 362 Effective length of database: 563 Effective search space: 203806 Effective search space used: 203806 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory