Align 5-aminopentanamidase (EC 3.5.1.30) (characterized)
to candidate CA265_RS07705 CA265_RS07705 carbon-nitrogen hydrolase
Query= reanno::pseudo5_N2C3_1:AO356_14225 (264 letters) >FitnessBrowser__Pedo557:CA265_RS07705 Length = 502 Score = 89.4 bits (220), Expect = 1e-22 Identities = 77/255 (30%), Positives = 123/255 (48%), Gaps = 26/255 (10%) Query: 26 ALEARGADVLVLPEMFMTG----YNI--GVDAVNVLAEVYNGEWAQQIGRIAKAANLAIV 79 AL +D ++ PE+F T YN ++A+ LAE E Q++ + + N I+ Sbjct: 246 ALSGYKSDFVMFPELFNTPLLQPYNHLPEIEAMRKLAEKTE-EIVQKMHEYSLSYNTNII 304 Query: 80 YGYPERGEDGQIYNAVQLIDAQGERLANYRKSHLFGDLDHAMFSAGDSALPIVELNGWKL 139 G EDG++YNA L G ++ YRK H+ + G + + + + K+ Sbjct: 305 TGSMPLIEDGKLYNATYLCHRTG-KIDEYRKIHITPNEQKYYGMIGGDKVQVFDTDCGKV 363 Query: 140 GLLICYDLEFPENARRLALAGAELILVP--TANMQPYEFIADVTVRARAIENQCFVAYAN 197 G+LICYD+EFPE +R A G +++ VP T Y + +ARAIEN+C+VA A Sbjct: 364 GILICYDVEFPELSRIYADQGMQILFVPFLTDTQNGYTRVRH-CAQARAIENECYVAIAG 422 Query: 198 YCG-----HEAELQYCGQSSIAAP-------NGSRPALAGLDEALIVGELDRQLLDDSR- 244 G + ++Q+ QS++ P N + E ++V ++D LLD+ Sbjct: 423 CVGNLPKVNNMDIQF-AQSAVFTPSDFAFPTNAIKAEATPNTEMVLVVDVDLHLLDELHH 481 Query: 245 -AAYNYLHDRRPELY 258 L DRR +LY Sbjct: 482 YGTVKVLKDRRKDLY 496 Lambda K H 0.321 0.139 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 502 Length adjustment: 29 Effective length of query: 235 Effective length of database: 473 Effective search space: 111155 Effective search space used: 111155 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory