Align 5-aminovalerate transaminase (EC 2.6.1.48) (characterized)
to candidate CA265_RS15205 CA265_RS15205 aspartate aminotransferase family protein
Query= BRENDA::Q9I6M4 (426 letters) >FitnessBrowser__Pedo557:CA265_RS15205 Length = 378 Score = 197 bits (500), Expect = 6e-55 Identities = 124/347 (35%), Positives = 185/347 (53%), Gaps = 36/347 (10%) Query: 30 RAENSTVWDVEGREYIDFAGGIAVLNTGHLHPKVIAAVQEQLGKLSHTCFQVLAYEPYIE 89 RA+ ++D + +++ID GI V N GH HP V+ A+QEQ + T ++ Y Y++ Sbjct: 6 RAKGIYIYDAQNKKHIDLIAGIGVSNVGHCHPAVVKAIQEQ----AETYMHLMVYGEYVQ 61 Query: 90 LAE-EIAKRVPGDFPKK---TLLVTSGSEAVENAVKIARAATGRAGVIAFTGAYHGRTMM 145 + AK + P+ T + SG+EAVE A+K+A+ TGR G IA AYHG T Sbjct: 62 TPQVNFAKALADILPESLSCTYFLNSGTEAVEGAMKLAKRYTGRKGFIACKNAYHGSTQG 121 Query: 146 TLGLTGKVVPYSAGMG-LMPGGIFRALAPCELHGVSEDDSIASIERIFKNDAQPQDIAAI 204 L YS+G G +P F E +++A +E+I +IAA+ Sbjct: 122 AESLMESDF-YSSGYGPFLPHVSF-----------IEHNNLADLEKI------TNEIAAV 163 Query: 205 IIEPVQGEGGFYVNSKSFMQRLRALCDQHGILLIADEVQTGAGRTGTFFATEQLGIVPDL 264 IEP+QGE G V+ S+MQ LR C + G LLI DE+Q+G GR+G FA E +VPD+ Sbjct: 164 FIEPIQGEAGIRVSDLSYMQALRTKCTETGTLLIFDEIQSGFGRSGKMFAFEHYNVVPDV 223 Query: 265 TTFAKSVGGGFPISGVAGKAEIMDAIAPGGLGG---TYAGSPIACAAALAVLKVFEEEKL 321 AK +GGG PI EIM ++ + G T+ G P+ CAA LA L+ ++ + Sbjct: 224 LLLAKGIGGGMPIGAFISSLEIMSVLSHTPILGHMTTFGGHPVCCAAGLATLRTLVDDHI 283 Query: 322 LERSQAVGERLKAGLREIQAKHKVIGDVRGLGSMVAIELFEGGDTHK 368 ++ + G+ K L +H I ++RG G M+A+E FE + +K Sbjct: 284 VDEVEEKGQLFKQLL-----QHPAIKEIRGKGLMLAVE-FENFEINK 324 Lambda K H 0.319 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 365 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 378 Length adjustment: 31 Effective length of query: 395 Effective length of database: 347 Effective search space: 137065 Effective search space used: 137065 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory