Align ABC transporter for L-Lysine, ATPase component (characterized)
to candidate CA265_RS04345 CA265_RS04345 lipoprotein-releasing system ATP-binding protein LolD
Query= reanno::pseudo6_N2E2:Pf6N2E2_2962 (254 letters) >FitnessBrowser__Pedo557:CA265_RS04345 Length = 216 Score = 132 bits (331), Expect = 8e-36 Identities = 83/226 (36%), Positives = 130/226 (57%), Gaps = 14/226 (6%) Query: 4 LTIEGLHKSYGEHEVLKGVSLKAKTGDVISLIGASGSGKSTFLRCINFLEQPNDGAMSLD 63 L G+ KSYG ++LKGV+ + + G+++S+IG SG+GKST L + L++P+DG++ L Sbjct: 2 LKATGIRKSYGNLQILKGVNFEVQKGEIVSIIGPSGAGKSTLLHILGTLDKPDDGSVQLK 61 Query: 64 GQPIQMIKDRHGMHVADADELQRIRTR-LAMVFQHFNLWSHMTVLENITMAPRRVLGVSK 122 G I + + D L R + + VFQ +L + +ENI + P + +K Sbjct: 62 GTVINKL---------NGDLLSTFRNQNIGFVFQFHHLLPEFSAIENICI-PAFIAKTNK 111 Query: 123 QEADDRARRYLDKVGLPARVAEQYPAFLSGGQQQRVAIARALAMEPEVMLFDEPTSALDP 182 ++A+ RA LD GL R A+ P LSGG+QQRVAIARAL P ++L DEP+ LD Sbjct: 112 KQAETRAFELLDLFGLKDR-AQHKPNQLSGGEQQRVAIARALINNPSIILADEPSGNLDS 170 Query: 183 ELVGEVLKVIQGLAEE-GRTMIMVTHEMSFARKVSNQVLFLHQGLV 227 E + ++ L + +T ++VTH A K S++V+ + GL+ Sbjct: 171 ENAAGLHQLFVSLRDNFHQTFVIVTHNEHLA-KTSDRVVSMKDGLI 215 Lambda K H 0.319 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 216 Length adjustment: 23 Effective length of query: 231 Effective length of database: 193 Effective search space: 44583 Effective search space used: 44583 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory