Align aminobutyraldehyde dehydrogenase (EC 1.2.1.19) (characterized)
to candidate CA265_RS14635 CA265_RS14635 aldehyde dehydrogenase
Query= BRENDA::P77674 (474 letters) >FitnessBrowser__Pedo557:CA265_RS14635 Length = 501 Score = 300 bits (769), Expect = 6e-86 Identities = 170/463 (36%), Positives = 257/463 (55%), Gaps = 15/463 (3%) Query: 23 NPATGDVLLEIAEASAEQVDAAVRAADAAFAEWGQTTPKVRAECLLKLADVIEENGQVFA 82 +P G V + A ++ E ++ AV AA AF W +T+ R+ L K+A +E+N + A Sbjct: 35 SPIDGKVFTKAAHSTKEDLELAVDAAHEAFKTWSKTSSTERSIILNKIAQRMEDNLEYLA 94 Query: 83 ELESRNCGKPLHSAFNDEIPAIVDVFRFFAGAARCLNGLAAGEYLEGHTSMIRRDPLGVV 142 +E+ + GK + ++P VD FR+FAG R G + E + S+I +P+GVV Sbjct: 95 AVETIDNGKAVRETLAADLPLGVDHFRYFAGVIRAEEG-SLSELDQNTVSLIVHEPIGVV 153 Query: 143 ASIAPWNYPLMMAAWKLAPALAAGNCVVLKPSEITPLTALKLAELAKDIFPAGVINILFG 202 A I PWN+PL+M WKLAPALAAGNCVVLKP+E TP++ + L EL D+ P GV+N++ G Sbjct: 154 AQIIPWNFPLLMGIWKLAPALAAGNCVVLKPAESTPVSIMVLMELIGDLLPPGVVNVVNG 213 Query: 203 RGKTVGDPLTGHPKVRMVSLTGSIATGEHIISHTASSIKRTHMELGGKAPVIVF------ 256 G +G L +PKV + TGS TG ++ + +I +ELGGK+P I F Sbjct: 214 FGSELGRALVTNPKVSKAAFTGSTPTGRLVMQYATENIIPVTLELGGKSPNIFFSSVMAE 273 Query: 257 DDADIEAVVEGVRTFGYYNAGQDCTAACRIYAQKGIYDTLVEKLGAAVATLKSGAPDDES 316 DDA ++ VEG F N G+ CT R+ Q+ IY+ + K+ +K G+P D + Sbjct: 274 DDAFLDKAVEGAVMFA-LNQGEICTCPSRLLIQEDIYEKFIAKVIERTKAIKIGSPLDRT 332 Query: 317 TELGPLSSLAHLERVGKAVEEAKATGHIKVITGGEKRK-----GNGYYYAPTLLAGALQD 371 +G +S E++ ++ K G +V+TGGE + G GYY PT+ G Sbjct: 333 VMMGAQASKIQFEKIAAYIKLGKEEG-AEVLTGGEINELPGELGGGYYIKPTIFKGH-NK 390 Query: 372 DAIVQKEVFGPVVSVTPFDNEEQVVNWANDSQYGLASSVWTKDVGRAHRVSARLQYGCTW 431 I Q+E+FGPV++VT F E+ + AND+ YGL + VWT+D ++V +Q G W Sbjct: 391 MRIFQEEIFGPVLAVTTFKTVEEAIEIANDTLYGLGAGVWTRDAHELYQVPRAIQAGRVW 450 Query: 432 VNTHFMLVSEMPHGGQKLSGYGKDMSLYGLEDYTVVRHVMVKH 474 VN + + P GG K SG G++ L Y +++++ + Sbjct: 451 VNQYHAYPAGAPFGGYKQSGVGRENHKMMLGHYRQTKNMLISY 493 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 559 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 474 Length of database: 501 Length adjustment: 34 Effective length of query: 440 Effective length of database: 467 Effective search space: 205480 Effective search space used: 205480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory