Align Beta-phosphoglucomutase; Beta-PGM; EC 5.4.2.6 (characterized)
to candidate CA265_RS06960 CA265_RS06960 haloacid dehalogenase
Query= SwissProt::P77366 (219 letters) >FitnessBrowser__Pedo557:CA265_RS06960 Length = 221 Score = 81.3 bits (199), Expect = 1e-20 Identities = 60/198 (30%), Positives = 91/198 (45%), Gaps = 21/198 (10%) Query: 2 KLQGVIFDLDGVITDTAHLHFQAWQQIAAE---IGISIDAQFNESLKGISRDESLRRI-- 56 K + +FDL+G + D H AW I + IS DA + + G ++D L R+ Sbjct: 5 KPKAFLFDLNGTMIDDMAFHNHAWHNILTQDLGASISFDA-VKKQMYGKNQD-LLERVFG 62 Query: 57 LQHGGKEG----DFNSQERAQLAYRKNLLYVHSLRELTVNAVLPGIRSLLADLRAQQISV 112 + H +E + R Q AY+K+L + L + A G+ Q+++ Sbjct: 63 VGHFSQEQIDQISIEKEHRYQAAYKKHLTLIAGLGDFLEKAKQSGV----------QMAI 112 Query: 113 GLASVSLNAPTILAALELREFFTFCADASQLKNSKPDPEIFLAACAGLGVPPQACIGIED 172 G A++ N +L L +R +F A + NSKPDPE F LGV CI ED Sbjct: 113 GSAAIPFNINFVLDNLNIRSYFKTIVSAEDVVNSKPDPETFSKGAEILGVAASECIVFED 172 Query: 173 AQAGIDAINASGMRSVGI 190 A G++A +GMR V + Sbjct: 173 APKGVEAALHAGMRCVAL 190 Lambda K H 0.320 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 104 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 219 Length of database: 221 Length adjustment: 22 Effective length of query: 197 Effective length of database: 199 Effective search space: 39203 Effective search space used: 39203 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory