Align mannose-1-phosphate guanylyltransferase (EC 2.7.7.13) (characterized)
to candidate CA265_RS08895 CA265_RS08895 mannose-1-phosphate guanylyltransferase
Query= BRENDA::P07874 (481 letters) >FitnessBrowser__Pedo557:CA265_RS08895 Length = 363 Score = 209 bits (532), Expect = 1e-58 Identities = 121/359 (33%), Positives = 202/359 (56%), Gaps = 22/359 (6%) Query: 4 VILSGGSGSRLWPLSRKQYPKQFLALTG-DDTLFQQTIKRLAFDGMQAPLLVCNKEHRFI 62 +I++GG GSR WP+SR +YPKQF+ G TL Q T R L +C E+ FI Sbjct: 8 LIMAGGVGSRFWPVSRTEYPKQFIDFFGVGKTLIQSTYDRF--------LKICLPENIFI 59 Query: 63 VQEQL-------EAQNLASQAILLEPFGRNTAPAVAIAAMKLVAEGRDELLLILPADHVI 115 V ++ + L++ IL EP RNTAP +A ++K+ + +++ P+DH I Sbjct: 60 VTNEIYSDLVKEQLPQLSANQILAEPLLRNTAPCIAYGSLKIAQLNPNATIVVAPSDHTI 119 Query: 116 EDQRAFQQALALATNAAEKGE-MVLFGIPASRPETGYGYIRASADA-QLPEGVSRVQSFV 173 + F +++ + +AA K + ++ GI +RP+TGYGYI+ + + +V++F Sbjct: 120 ANIDGFIESIQQSLDAASKNDCLITLGIKPNRPDTGYGYIQHTDYVLNTDTDLHKVKTFT 179 Query: 174 EKPDEARAREFVAAGGYYWNSGMFLFRASRYLEELKKHDADIYDTCLLALERSQHDGDLV 233 EKP+ A+ F+ +G + WN+G+F++ A L +KH D+Y+ + +G+ Sbjct: 180 EKPNLELAKSFLQSGDFLWNAGIFIWSAKAILSAFEKHLPDMYEIFNIGRSELNTEGEKA 239 Query: 234 NIDAATFECCPDNSIDYAVMEKTSRACVVPLSAGWNDVGSWSSIWDVHAKDANGN--VTK 291 I+ A F+ C + SID+ +MEK V+P GW+D+G+W+SI+++ KD GN + Sbjct: 240 FINNAYFQ-CTNISIDFGIMEKAENVYVLPSDFGWSDLGTWASIYEMAEKDYVGNAVIPS 298 Query: 292 GDVLVHDSHNCLVH-GNGKLVSVIGLEDIVVVETKDAMMIAHKDRVQDVKHVVKDLDAQ 349 VL+ DS NC+V+ KLV + GL D +VVE + +MI ++ Q VK V ++ ++ Sbjct: 299 EQVLMFDSSNCMVNVPKDKLVILQGLHDYIVVENNNMLMICPRNEEQRVKEFVAEVKSR 357 Lambda K H 0.319 0.134 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 403 Number of extensions: 12 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 481 Length of database: 363 Length adjustment: 32 Effective length of query: 449 Effective length of database: 331 Effective search space: 148619 Effective search space used: 148619 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory