Align NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; Allergen Alt a 8; EC 1.1.1.138 (characterized)
to candidate CA265_RS09980 CA265_RS09980 NAD(P)-dependent oxidoreductase
Query= SwissProt::P0C0Y4 (266 letters) >FitnessBrowser__Pedo557:CA265_RS09980 Length = 284 Score = 96.3 bits (238), Expect = 6e-25 Identities = 83/260 (31%), Positives = 130/260 (50%), Gaps = 26/260 (10%) Query: 17 LKGKVVIVTGASGPTGIGTEAARGCAEYGADLAITYNSRAEGAEKNAKEMSEKYGVKVKA 76 L +V ++TG G +GIG A A GAD+AI Y + A K ++M E G K Sbjct: 38 LNNQVALITG--GDSGIGRSVAVHFAREGADVAIVYLNEDIDA-KETQKMVEAEGKKCLL 94 Query: 77 YKCQVNEYAQCEKLVQDVIKDFGKVDVFIANAG--------KTADNGILDATVEQWNEVI 128 K V + A C+K V++ IK FGK+++ + NAG K DN +Q + Sbjct: 95 IKGDVKKPAFCKKAVENTIKQFGKINILVNNAGMQVPQKDPKKIDN-------KQLEDTF 147 Query: 129 QTDLTGTFNCARAVGLHFRERKTGSLVITSSMSGHIANFPQEQASYNVAKAGCIHLAKSL 188 +T++ G F A V HF + S++ T+S++ + ++ Y+ K +SL Sbjct: 148 RTNIFGYFYFAHEVLEHF--KPGDSIINTTSVTAYRSS--PNLIDYSSTKGAITSFTRSL 203 Query: 189 A-NEWRDFARVNSISPGYIDTGL--SDFVPQDIQKLWHSMIPMGRDAKATELKGAYVYFA 245 A N RVN+++PG + T L S F + I K + S M R + +E+ AYV+ A Sbjct: 204 ATNLATKGIRVNAVAPGPVWTPLIVSTFDEKKI-KSFGSQTAMERAGQPSEIAPAYVFLA 262 Query: 246 SDASSYCTGSDLLIDGGYCV 265 SD +S+ TG + ++GG V Sbjct: 263 SDDASFITGQVIHVNGGEVV 282 Lambda K H 0.316 0.132 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 284 Length adjustment: 25 Effective length of query: 241 Effective length of database: 259 Effective search space: 62419 Effective search space used: 62419 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory