Align NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; Allergen Alt a 8; EC 1.1.1.138 (characterized)
to candidate CA265_RS15450 CA265_RS15450 3-oxoacyl-[acyl-carrier-protein] reductase
Query= SwissProt::P0C0Y4 (266 letters) >FitnessBrowser__Pedo557:CA265_RS15450 Length = 247 Score = 149 bits (377), Expect = 4e-41 Identities = 85/247 (34%), Positives = 136/247 (55%), Gaps = 6/247 (2%) Query: 17 LKGKVVIVTGASGPTGIGTEAARGCAEYGADLAITYNSRAEGAEKNAKEMSEKYGVKVKA 76 L+GK +VTGAS GIG + A AE GA++A TY S E E +E+ + +G KVK Sbjct: 4 LEGKTALVTGAS--KGIGRKIAEKFAEQGANVAFTYLSSVEKGEALEQEL-QSFGTKVKG 60 Query: 77 YKCQVNEYAQCEKLVQDVIKDFGKVDVFIANAGKTADNGILDATVEQWNEVIQTDLTGTF 136 Y+ +++A+ E+L+ D++ +FG +D+ + NAG T D ++ + E W++VI +L F Sbjct: 61 YRSDASKFAEAEQLINDIVAEFGTIDIVVNNAGITKDGLLMRMSEENWDDVININLKSIF 120 Query: 137 NCARAVGLHFRERKTGSLVITSSMSGHIANFPQEQASYNVAKAGCIHLAKSLANEWRD-F 195 N +A + + G + S+ G N QA+Y +KAG I KS+A E Sbjct: 121 NVTKAASKVMMKARKGVFINMGSIVGTTGN--GGQANYAASKAGIIGFTKSIAKELGSRN 178 Query: 196 ARVNSISPGYIDTGLSDFVPQDIQKLWHSMIPMGRDAKATELKGAYVYFASDASSYCTGS 255 R N ++PG+I T ++D + + + W IP+ R + ++ V+ ASD S+Y TG Sbjct: 179 IRANVVAPGFIRTEMTDILDPKVVEGWEKDIPLKRAGETEDIANVCVFLASDMSAYVTGQ 238 Query: 256 DLLIDGG 262 L + GG Sbjct: 239 TLSVCGG 245 Lambda K H 0.316 0.132 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 9 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 247 Length adjustment: 24 Effective length of query: 242 Effective length of database: 223 Effective search space: 53966 Effective search space used: 53966 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory