Align TM1747, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate CA265_RS25300 CA265_RS25300 ABC transporter permease
Query= TCDB::Q9X269 (341 letters) >FitnessBrowser__Pedo557:CA265_RS25300 Length = 351 Score = 169 bits (428), Expect = 1e-46 Identities = 114/358 (31%), Positives = 187/358 (52%), Gaps = 55/358 (15%) Query: 27 FLLKRLLTIAISMVVVIVITYVLMWLAPGNFFELQRVRDAIARVTTPDDPAYQATLKGFE 86 + LK+L+ + M VI++ +VL + PG+ AR+T Q+ L+ Sbjct: 4 YALKKLMYGLLVMGGVILVVFVLFNILPGD----------PARMTMGQRADVQS-LEAVR 52 Query: 87 ERYGLNNPLWKQILMYL----------------------------KGAVVFKFG--PSFS 116 + +GL+ Q L+Y+ K A+V K+ S Sbjct: 53 KEFGLDRSKPVQFLLYINDLSPISILDNDSTNQQKYHYAKLMSFDKKALVIKWPYLRSSY 112 Query: 117 DPARNIEDLIKEKFPITFTLALSSILFALVVGVPLGILAALKKNTWIDYTAMTVSVIGVA 176 R++ ++ E P TF LAL++++FA ++GV LG+L+A+ K++WID TA +++G++ Sbjct: 113 QTKRDVTAILSETVPNTFILALTAMIFATIIGVFLGVLSAVYKDSWIDKTANAFAILGIS 172 Query: 177 IPSYVVAVFLILIFSIYLG---WLPTSG-------WEG----IRTKILPTIALALGPLAS 222 PS+ + + +F L L SG + G +R LP I L L PLA Sbjct: 173 APSFFAGIIIAWLFGFVLSNYTGLKMSGSLYSYDPFNGEVLTLRNLWLPMITLGLRPLAI 232 Query: 223 VARFTRVSLLDTLNQDFIRTAYAKGGDDRTVIMKHALRPSMIPLVTIVGPQMAYLMVGTV 282 + + TR ++LD L QD+IRTA AKG T+I KHAL+ +M P++T + A L+ G+ Sbjct: 233 IVQLTRSAMLDVLAQDYIRTARAKGLSRNTIIYKHALKNAMNPVITAISGWFASLLAGSF 292 Query: 283 WVENIFRIPGLGQLFANAAVTRDYPLLVTSTFILALTVMIMNLIVDVLYAILDPRIKL 340 +VE IF GLG+ A D+P+++ S +A +++N++VD+LYA +DPR+KL Sbjct: 293 FVEYIFGYNGLGRTTVTALEMSDFPVVMGSILFIAFVFVVINILVDILYAYVDPRVKL 350 Lambda K H 0.328 0.143 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 341 Length of database: 351 Length adjustment: 29 Effective length of query: 312 Effective length of database: 322 Effective search space: 100464 Effective search space used: 100464 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory