Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate CA265_RS16020 CA265_RS16020 ABC transporter ATP-binding protein
Query= TCDB::Q9X272 (328 letters) >FitnessBrowser__Pedo557:CA265_RS16020 Length = 250 Score = 120 bits (302), Expect = 3e-32 Identities = 73/222 (32%), Positives = 130/222 (58%), Gaps = 7/222 (3%) Query: 13 LLQTVDLKKYFPQGKRILKAVDGISIEIKEGETLGLVGESGCGKSTLGRTILKLLRPDGG 72 +++ D+ K F G +L+ GIS + +EG T ++G SG GK+TL + ++ L +PD G Sbjct: 1 MIEIKDIYKSF-SGNDVLQ---GISGKFEEGVTNLIIGGSGSGKTTLLKCMVGLHQPDSG 56 Query: 73 KIFFEGKDITNLNDKEMKPYRKKMQIIFQDPLGSLNPQMTVGRIIEDPLIIHKIGTKKER 132 + ++G+D T + ++ RK++ ++FQ +L MTV I PL + ++KE+ Sbjct: 57 SVLYDGRDFTPMTYEQRIEVRKEIGMLFQG--SALFDSMTVEENIMFPLNMFTDQSRKEK 114 Query: 133 RKRVEELLDMVGIGREFINSFPHEFSGGQQQRIGIARALALNPKFIVCDEPVSALDVSIQ 192 +RV+ L+ V + + FP E SGG ++R+GIARA+++NPK++ CDEP S LD Sbjct: 115 LERVDFCLERVNLAGKN-KLFPAELSGGMKKRVGIARAISMNPKYLFCDEPNSGLDPKTS 173 Query: 193 AQIIDLLEEIQQKMGISYLFIAHNLAVVEHISHKVAVMYLGK 234 I +L++EI ++ + + + H++ V I + ++ GK Sbjct: 174 IVIDELIQEITEEYKTTTIVVTHDMNSVMGIGDYILFLHEGK 215 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 250 Length adjustment: 26 Effective length of query: 302 Effective length of database: 224 Effective search space: 67648 Effective search space used: 67648 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory