Align Probable inositol transporter 3 (characterized)
to candidate CA265_RS01275 CA265_RS01275 hypothetical protein
Query= SwissProt::Q9ZQP6 (580 letters) >FitnessBrowser__Pedo557:CA265_RS01275 Length = 462 Score = 167 bits (423), Expect = 9e-46 Identities = 115/340 (33%), Positives = 177/340 (52%), Gaps = 33/340 (9%) Query: 25 YIMRLALSAGIGGLLFGYNTGVIAGALLYIKEEFGEVDNKTWLQEIIVSMTVAGAIVGAA 84 +I + L A +GG LFG++ V++G + +K ++G + + + VS + G IVG + Sbjct: 9 FIFLITLIAALGGFLFGFDMAVVSGIIEPLKSQYGLSSAQ---EGLFVSCALLGCIVGVS 65 Query: 85 IGGWYNDKFGRRMSVLIADVLFLLGALVMVIAHAPWVIILGRLLVGFGVGMASMTSPLYI 144 G+ +DK GRR + +A +LFL+ A+ + A V+I R+L G GVG+AS SPLYI Sbjct: 66 FSGYLSDKVGRRKVLFLAAILFLVSAVGFAFSVAYPVLIFFRVLAGMGVGVASNVSPLYI 125 Query: 145 SEMSPARIRGALVSTNGLLITGGQFLSYLINL-----AFVH------------TPGTWRW 187 SE++P++ RG LV L IT G +Y+ NL A VH WR Sbjct: 126 SEVAPSQKRGRLVVFYQLAITIGILAAYISNLFLQRYATVHAGAGEGILHWLFVENVWRG 185 Query: 188 MLGVSAIPAIIQFCLMLTLPESPRWLYRNDRKAESRDILERIYPAEMVEAEIAALKESVR 247 M V +PA L+L +PESPRWL + R E+ + L +I AE E+ ++KE Sbjct: 186 MFIVGVVPAAAFCLLLLIVPESPRWLVQYGRNEEALNTLIKINGAETGRLELDSIKEMAS 245 Query: 248 AETADEDIIGHTFSDKLRGALSNPVVRHGLAAGITVQVAQQFVGINTVMYYSPTILQFAG 307 ++ + + +R LS LA + QF GIN V++Y PTIL+ AG Sbjct: 246 QKSGG-------YKELMRLPLSKL-----LALATILTALSQFSGINGVIFYGPTILKSAG 293 Query: 308 YASNKTAMALALITSGLNAVGSVVSMMFVDRYGRRKLMII 347 ++ A+ +I N + + +++ VD +GRR L II Sbjct: 294 IVTS-DALFYQVILGSANVLFTFIAISKVDTWGRRPLYII 332 Score = 57.4 bits (137), Expect = 1e-12 Identities = 27/102 (26%), Positives = 58/102 (56%) Query: 456 GYLAIVFLGLYIIVYAPGMGTVPWIVNSEIYPLRYRGLAGGIAAVSNWMSNLVVSETFLT 515 G+ + + L+++ +A +G + +++++EI+P RG A + ++ W+S+ VV+ F Sbjct: 354 GWFMLFSIILFLLFFAFSLGPLKFVISTEIFPTHIRGTALSMCIMTMWVSDWVVNMLFPI 413 Query: 516 LTNAVGSSGTFLLFAGSSAVGLFFIWLLVPETKGLQFEEVEK 557 + + +G + TF +F+ + + + ETKG EE+EK Sbjct: 414 MRDGLGIATTFFIFSFFCILSFLYAKKKLFETKGKSLEEIEK 455 Lambda K H 0.323 0.137 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 708 Number of extensions: 42 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 580 Length of database: 462 Length adjustment: 35 Effective length of query: 545 Effective length of database: 427 Effective search space: 232715 Effective search space used: 232715 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory