Align Proton myo-inositol cotransporter; H(+)-myo-inositol cotransporter; Hmit; H(+)-myo-inositol symporter; Solute carrier family 2 member 13 (characterized)
to candidate CA265_RS23325 CA265_RS23325 MFS transporter
Query= SwissProt::Q96QE2 (648 letters) >FitnessBrowser__Pedo557:CA265_RS23325 Length = 443 Score = 210 bits (535), Expect = 9e-59 Identities = 111/331 (33%), Positives = 189/331 (57%), Gaps = 8/331 (2%) Query: 79 AFVYVVAVFSALGGFLFGYDTGVVSGAMLLLKRQLSLDALWQELLVSSTVGAAAVSALAG 138 A++ +++ +A GG+LFG+D V+SG++ L++Q L W+ S A V L Sbjct: 9 AYITFISLLAAGGGYLFGFDFAVISGSLPFLEKQFQLTPYWEGFATGSLALGAMVGCLIA 68 Query: 139 GALNGVFGRRAAILLASALFTAGSAVLAAANNKETLLAGRLVVGLGIGIASMTVPVYIAE 198 G ++ +GR+ +++A+ +F A S +A A N++ + R G+G+G+ASM P+YIAE Sbjct: 69 GYVSDAYGRKPGLMIAAFVFLASSLAMAMAPNRDFFIVSRFFSGIGVGMASMLSPMYIAE 128 Query: 199 VSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKDGWRYMLGLAAVPAVIQFFGFLF 258 ++PP RGRLV IN L I G ++++ +D WR+M GL A+P+ I G Sbjct: 129 LAPPKFRGRLVAINQLTIVLGILITNLINYTLRNTGEDAWRWMFGLGAIPSGIFLIGISI 188 Query: 259 LPESPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIEEEEKEVGSAGPVICRMLS 318 LPESPRWL+QKG+ +KA ++L+++ GN + D++KN + +++ I + Sbjct: 189 LPESPRWLVQKGKNEKALKVLNKI-GNH--EFAADALKNIEQTLQRKSNVEHESIFNKMY 245 Query: 319 YPPTRRALIVGCGLQMFQQLSGINTIMYYSATILQMSGVEDDRLAIWLASVTAFTNFIFT 378 +P A+++G GL +FQQ GINT+ Y+ + + G D + + A N IFT Sbjct: 246 FP----AVMIGIGLAIFQQFCGINTVFNYAPKLFESIGTSQDDQLLQTVFIGA-VNVIFT 300 Query: 379 LVGVWLVEKVGRRKLTFGSLAGTTVALIILA 409 + ++LV+K+GR+ L G V ++++ Sbjct: 301 ISAMFLVDKIGRKPLMLIGAGGLAVLYVLIS 331 Score = 47.4 bits (111), Expect = 1e-09 Identities = 33/106 (31%), Positives = 50/106 (47%), Gaps = 5/106 (4%) Query: 503 TPYSWTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSSGINWIFNVLVSLT 562 T SW L + +Y V AP + W + SEI+P R + W ++ T Sbjct: 339 TMVSWFLLSAIGVYAVSLAP----VTWVLISEIFPNKVRVKATTWAILCLWGAYFVLVFT 394 Query: 563 FLHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGKKLEEIESL 608 F ++L F++YA +G + I+ + ETKGK LEEIE + Sbjct: 395 FPILFDWLKE-SIFYIYAAICTLGCIGIWKFVKETKGKTLEEIEDI 439 Lambda K H 0.321 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 640 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 648 Length of database: 443 Length adjustment: 35 Effective length of query: 613 Effective length of database: 408 Effective search space: 250104 Effective search space used: 250104 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory