Align Sodium/myo-inositol cotransporter 2; Na(+)/myo-inositol cotransporter 2; Sodium-dependent glucose cotransporter; Sodium/glucose cotransporter KST1; Sodium/myo-inositol transporter 2; SMIT2; Solute carrier family 5 member 11 (characterized)
to candidate CA265_RS06130 CA265_RS06130 sodium transporter
Query= SwissProt::Q8WWX8 (675 letters) >FitnessBrowser__Pedo557:CA265_RS06130 Length = 558 Score = 270 bits (691), Expect = 1e-76 Identities = 167/477 (35%), Positives = 267/477 (55%), Gaps = 26/477 (5%) Query: 24 LEPGDIAVLVLYFLFVLAVGLWSTVKTKRDTV--KGYFLAGGDMVWWPVGASLFASNVGS 81 L+ D V +YF+ V A GL+ K K ++ K YFLA G + WW +GASL ASN+ + Sbjct: 6 LDTKDYIVFAIYFVIVAAYGLYIYNKKKSESTGSKDYFLAEGSLTWWAIGASLIASNISA 65 Query: 82 GHFIGLAGSGAATGISVSAYELNGLFSVLMLAWIFLPIYIAGQVTTMPEYLRKRFGGIRI 141 FIG++GSG G++++ YE G +++++A F+P+Y+ ++ TMP++L +R+ G + Sbjct: 66 EQFIGMSGSGFKMGLAIATYEWMGAATLVVVAVFFIPVYLKNKIATMPQFLHQRYNG-TV 124 Query: 142 PIILAVLYLFIYIFTKISVDMYAGAIFIQQSLHLDLYLAIVGLLAITAVYTVAGGLAAVI 201 +I+AV +L +Y+ ++ +Y GA+ + DL + + + T+ GG+ + Sbjct: 125 AMIMAVFWLLLYVVVNLTSILYLGALAVSSISGFDLSFCMYAIAGFAIIITL-GGMKVIG 183 Query: 202 YTDALQTLIMLIGALTLMGYSFAAVG---GMEGLKEKYFLALASNRSENSSCGLPREDAF 258 YTD +Q +++G L + V G G+ E Y L + S SE+ L E+ Sbjct: 184 YTDVIQVFFLILGGLATTYLALNLVSTHYGTTGIFEGYSL-MTSKASEHFHMILKPENEN 242 Query: 259 HIFRDPLTSDLPWPGVLF-GMSIPSLWYWCTDQVIVQRTLAAKNLSHAKGGALMAAYLKV 317 +I DLP VL GM I +L YW +Q I QR L A NL A+GG L AA+LK+ Sbjct: 243 YI-------DLPGLSVLVGGMWIVNLNYWGCNQYITQRALGA-NLETARGGILFAAFLKL 294 Query: 318 LPLFIMVFPGMVSRILFPDQVACADPEICQKICSNPSGCSDIAYPKLVLELLPTGLRGLM 377 L I+V PG+ + +LF D E+ Q NP D AYP ++L LLP GL+GL Sbjct: 295 LMPIIVVLPGIAAYVLFKD--GAFQSEMLQDGAVNP----DRAYP-VLLNLLPAGLKGLS 347 Query: 378 MAVMVAALMSSLTSIFNSASTIFTMDLWNH-LRPRASEKELMIVGRVFVLLLVLVSILWI 436 A + AA+++SL NS +TIFT+D++ LR A+EK L+ G++ +++ +++ +L Sbjct: 348 FAALTAAVVASLAGKANSIATIFTLDIYKKVLRTDATEKNLVTTGKISIIVAMILGVLIA 407 Query: 437 PVVQASQGGQLFIYIQSISSYLQPPVAVVFIMGCFWKRTNEKGAFWGLISGLLLGLV 493 P + + G F YIQ + ++ P + +FI+G FWKRT A + I G L ++ Sbjct: 408 PHLGIDKKGG-FQYIQEYTGFVSPGIFAMFILGFFWKRTTSTAALFATIGGFGLSIL 463 Lambda K H 0.325 0.139 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 793 Number of extensions: 38 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 675 Length of database: 558 Length adjustment: 37 Effective length of query: 638 Effective length of database: 521 Effective search space: 332398 Effective search space used: 332398 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory