Align myo-inositol 2-dehydrogenase (EC 1.1.1.18) (characterized)
to candidate CA265_RS23295 CA265_RS23295 oxidoreductase
Query= metacyc::MONOMER-13035 (337 letters) >FitnessBrowser__Pedo557:CA265_RS23295 Length = 484 Score = 55.8 bits (133), Expect = 2e-12 Identities = 43/154 (27%), Positives = 77/154 (50%), Gaps = 7/154 (4%) Query: 3 LKLGVIGAGAIGKEHIRRCTQVLQGATVVAVSDINADNARAAVALPGV-QAEVYADGHDV 61 L+L IGAG G+ I +++G + D+ RAA +L +A+ Y D ++ Sbjct: 48 LQLAGIGAGGKGESDI---ASIVRGGKTDVAFLCDVDDRRAANSLKNFPKAKYYKDYREL 104 Query: 62 I--KASDVDAVLVTSWDPTHEEYTLAAIEAGKPVFCEKPLAMSAEGCRRIVDAEMKAGRR 119 + + ++DAV V++ D TH + +AA++ GK V+ +KPL R + +A + + Sbjct: 105 LDKEGKNIDAVTVSTPDHTHAQIAMAAMQLGKHVYVQKPLTHDIYEARMLTEAANRY-KV 163 Query: 120 LVQVGFMRPYDEGYLALKKVIDDGDIGAPLMLRC 153 + Q+G +G L++ D G IG + C Sbjct: 164 VTQMGNQGASGDGVRRLQEWYDAGRIGKVHTVYC 197 Lambda K H 0.319 0.134 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 484 Length adjustment: 31 Effective length of query: 306 Effective length of database: 453 Effective search space: 138618 Effective search space used: 138618 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory